From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004791000
  • symbol?: cspR
  • description?: tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL

      descriptions from strain specific annotations:

    • tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL
    • RNA methyltransferase
    • SpoU rRNA methylase family protein
    • rRNA methylase-like protein
    • tRNA (cytosine34-2-O-)-methyltransferase
    • 23S rRNA methyltransferase
    • RNA methyltransferase, TrmH family, group 2
    • rRNA methylase
    • TrmH family RNA methyltransferase
  • strand?: -
  • coordinates?: 4998607..4999077
  • synteny block?: BlockID0037230
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1811
    08BA02176:
    C248_1899
    11819-97:
    MS7_1860
    71193:
    ST398NM01_1921
    ECT-R 2:
    ECTR2_1697
    ED133:
    SAOV_1852
    ED98:
    SAAV_1874
    HO 5096 0412:
    SAEMRSA15_17600
    JH1:
    SaurJH1_1943
    JH9:
    SaurJH9_1909
    JKD6008:
    SAA6008_01812
    JKD6159:
    SAA6159_01784
    LGA251:
    SARLGA251_17380
    M013:
    M013TW_1861
    MRSA252:
    SAR1946
    MSHR1132:
    SAMSHR1132_17010
    MSSA476:
    SAS1778
    Mu3:
    SAHV_1840
    Mu50:
    SAV1855
    MW2:
    MW1796
    RF122:
    SAB1789c
    ST398:
    SAPIG1921
    T0131:
    SAT0131_01975
    TCH60:
    HMPREF0772_11289
    TW20:
    SATW20_18490
    USA300_TCH1516:
    USA300HOU_1850
    VC40:
    SAVC_08525

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTNHIVLYQPEIPANTGNIARTCAGTNTHLHLIKPLGFRTDDKMLKRAGLDYWEFVNITY
    N315            MTNHIVLYQPEIPANTGNIARTCAGTNTHLHLIKPLGFRTDDKMLKRAGLDYWEFVNITY
    NCTC8325        MTNHIVLYQPEIPANTGNIARTCAGTNTHLHLIKPLGFRTDDKMLKRAGLDYWEFVNITY
    Newman          MTNHIVLYQPEIPANTGNIARTCAGTNTHLHLIKPLGFRTDDKMLKRAGLDYWEFVNITY
    USA300_FPR3757  MTNHIVLYQPEIPANTGNIARTCAGTNTHLHLIKPLGFRTDDKMLKRAGLDYWEFVNITY
                    ************************************************************

    COL             HDSIEAFFEVTNGEYYLLTKFGKKTYSDFDFSNHDKDFYFIFGKETTGLPDWVKEKYQDT
    N315            HDSIEAFFEATNGEYYLLTKFGKKTYSDFDFSNHDKDFYFIFGKETTGLPDWVKEKYQDT
    NCTC8325        HDSIEAFFEVTNGEYYLLTKFGKKTYSDFDFSNHDKDFYFIFGKETTGLPDWVKEKYQDT
    Newman          HDSIEAFFEVTNGEYYLLTKFGKKTYSDFDFSNHDKDFYFIFGKETTGLPDWVKEKYQDT
    USA300_FPR3757  HDSIEAFFEVTNGEYYLLTKFGKKTYSDFDFSNHDKDFYFIFGKETTGLPDWVKEKYQDT
                    *********.**************************************************

    COL             ALRIPMSEHIRSLNLSNTAALLIYEALRQQDFPGLN
    N315            ALRIPMSEHIRSLNLSNTAALLIYEALRQQDFPGLN
    NCTC8325        ALRIPMSEHIRSLNLSNTAALLIYEALRQQDFPGLN
    Newman          ALRIPMSEHIRSLNLSNTAALLIYEALRQQDFPGLN
    USA300_FPR3757  ALRIPMSEHIRSLNLSNTAALLIYEALRQQDFPGLN
                    ************************************