From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004793000
  • symbol?: glnQ
  • description?: glutamate ABC transporter ATP-binding protein

      descriptions from strain specific annotations:

    • glutamate ABC transporter ATP-binding protein
    • amino acid ABC transporter ATP-binding protein
    • Glutamine transport ATP-binding protein glnQ
    • L-cystine import ATP-binding protein tcyC
    • glutamine transport ATP-binding protein
    • ABC transporter family protein
    • phosphate ABC transporter ATP-binding protein
    • glutamate ABC superfamily ATP binding cassette transporter, ABC protein
    • ABC transporter-like protein
    • glutamate ATP-binding ABC transporter
    • ArtP
    • glutamate transport ATP-binding protein
  • strand?: -
  • coordinates?: 5000360..5001082
  • synteny block?: BlockID0037250
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1813 (glnQ)
    08BA02176:
    C248_1901 (glnQ)
    11819-97:
    MS7_1862
    71193:
    ST398NM01_1923
    ECT-R 2:
    ECTR2_1699
    ED133:
    SAOV_1854 (glnQ)
    ED98:
    SAAV_1876
    HO 5096 0412:
    SAEMRSA15_17620 (glnQ)
    JH1:
    SaurJH1_1945
    JH9:
    SaurJH9_1911
    JKD6008:
    SAA6008_01814 (glnQ)
    JKD6159:
    SAA6159_01786 (glnQ)
    LGA251:
    SARLGA251_17400 (glnQ)
    M013:
    M013TW_1863
    MRSA252:
    SAR1948 (glnQ)
    MSHR1132:
    SAMSHR1132_17030
    MSSA476:
    SAS1780
    Mu3:
    SAHV_1842
    Mu50:
    SAV1857
    MW2:
    MW1798
    RF122:
    SAB1791c (glnQ)
    ST398:
    SAPIG1923
    T0131:
    SAT0131_01977
    TCH60:
    HMPREF0772_11287
    TW20:
    SATW20_18510 (glnQ)
    USA300_TCH1516:
    USA300HOU_1852 (glnQ)
    VC40:
    SAVC_08535

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MPVIKINNLNKVFGDNEVLKDINLEINQGEVVAIIGPSGSGKSTLLRCMNLLEVPTKGQV
    N315            MPVIKINNLNKVFGDNEVLKDINLEINQGEVVAIIGPSGSGKSTLLRCMNLLEVPTKGQV
    NCTC8325        MPVIKINNLNKVFGDNEVLKDINLEINQGEVVAIIGPSGSGKSTLLRCMNLLEVPTKGQV
    Newman          MPVIKINNLNKVFGDNEVLKDINLEINQGEVVAIIGPSGSGKSTLLRCMNLLEVPTKGQV
    USA300_FPR3757  MPVIKINNLNKVFGDNEVLKDINLEINQGEVVAIIGPSGSGKSTLLRCMNLLEVPTKGQV
                    ************************************************************

    COL             IFEGNDLTEKGTQVDKLRQKMGMVFQNFNLFPHKKVVDNIILAPKLLKKDNNDELHKEAL
    N315            IFEGNDLTEKGTQVDKLRQKMGMVFQNFNLFPHKKVVDNIILAPKLLKKDNNDELHKEAL
    NCTC8325        IFEGNDLTEKGTQVDKLRQKMGMVFQNFNLFPHKKVVDNIILAPKLLKKDNNDELHKEAL
    Newman          IFEGNDLTEKGTQVDKLRQKMGMVFQNFNLFPHKKVVDNIILAPKLLKKDNNDELHKEAL
    USA300_FPR3757  IFEGNDLTEKGTQVDKLRQKMGMVFQNFNLFPHKKVVDNIILAPKLLKKDNNDELHKEAL
                    ************************************************************

    COL             SLLDKVGLKEKADVYPNQLSGGQKQRVAIARALAMHPDVILFDEPTSALDPEVVGDVLKV
    N315            SLLDKVGLKEKADVYPNQLSGGQKQRVAIARALAMHPDVILFDEPTSALDPEVVGDVLKV
    NCTC8325        SLLDKVGLKEKADVYPNQLSGGQKQRVAIARALAMHPDVILFDEPTSALDPEVVGDVLKV
    Newman          SLLDKVGLKEKADVYPNQLSGGQKQRVAIARALAMHPDVILFDEPTSALDPEVVGDVLKV
    USA300_FPR3757  SLLDKVGLKEKADVYPNQLSGGQKQRVAIARALAMHPDVILFDEPTSALDPEVVGDVLKV
                    ************************************************************

    COL             MKDLAKEGMTMVVVTHEMGFAKDVSDKVIFMADGVVVESGTPVEIFEQPQHERTQNFLAR
    N315            MKDLAKEGMTMVVVTHEMGFAKDVSDKVIFMADGVVVESGTPVEIFEQPQHERTQNFLAR
    NCTC8325        MKDLAKEGMTMVVVTHEMGFAKDVSDKVIFMADGVVVESGTPVEIFEQPQHERTQNFLAR
    Newman          MKDLAKEGMTMVVVTHEMGFAKDVSDKVIFMADGVVVESGTPVEIFEQPQHERTQNFLAR
    USA300_FPR3757  MKDLAKEGMTMVVVTHEMGFAKDVSDKVIFMADGVVVESGTPVEIFEQPQHERTQNFLAR
                    ************************************************************

    COL             VL
    N315            VL
    NCTC8325        VL
    Newman          VL
    USA300_FPR3757  VL
                    **