Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_1807 [new locus tag: SAUSA300_RS09890 ]
  • pan locus tag?: SAUPAN004793000
  • symbol: SAUSA300_1807
  • pan gene symbol?: glnQ
  • synonym:
  • product: amino acid ABC transporter ATP-binding protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAUSA300_1807 [new locus tag: SAUSA300_RS09890 ]
  • symbol: SAUSA300_1807
  • product: amino acid ABC transporter ATP-binding protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1989653..1990381
  • length: 729
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGCCAGTGATTAAAATAAACAATCTTAATAAAGTTTTTGGAGATAATGAAGTTTTAAAA
    GATATCAATCTTGAAATCAATCAAGGGGAAGTAGTAGCAATAATAGGTCCATCTGGTAGT
    GGTAAAAGTACATTGTTAAGATGTATGAATTTATTAGAAGTACCTACTAAAGGTCAAGTG
    ATTTTTGAAGGCAATGACTTAACGGAAAAAGGGACACAAGTAGATAAACTACGTCAAAAA
    ATGGGTATGGTATTTCAAAACTTCAACCTATTTCCACATAAAAAAGTTGTCGATAATATT
    ATTTTAGCTCCTAAATTATTAAAGAAAGATAATAACGATGAATTACATAAGGAAGCATTG
    TCGTTATTAGATAAAGTGGGATTAAAAGAAAAAGCAGATGTATATCCGAATCAATTATCA
    GGTGGTCAAAAACAAAGGGTAGCAATTGCAAGAGCTTTAGCAATGCATCCAGATGTTATT
    TTATTCGATGAACCAACTTCAGCATTAGATCCTGAGGTAGTTGGTGATGTATTAAAAGTA
    ATGAAAGACCTAGCCAAAGAAGGTATGACCATGGTGGTTGTGACACATGAAATGGGATTT
    GCCAAAGATGTAAGTGACAAAGTCATATTTATGGCAGATGGCGTTGTCGTAGAGTCAGGC
    ACACCAGTCGAAATATTTGAACAACCGCAACATGAAAGAACACAAAATTTCTTAGCAAGA
    GTATTATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    729

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAUSA300_1807 [new locus tag: SAUSA300_RS09890 ]
  • symbol: SAUSA300_1807
  • description: amino acid ABC transporter ATP-binding protein
  • length: 242
  • theoretical pI: 5.70084
  • theoretical MW: 26768
  • GRAVY: -0.120248

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 292.9)
    MetabolismTransport and binding proteinsAnionsphosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 273.3)
    D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 232.2)
    MetabolismTransport and binding proteinsAnionsphosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 226.2)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesputative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 220.1)
    MetabolismTransport and binding proteinsAnionssulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 218.9)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesglycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 215)
    MetabolismTransport and binding proteinsUnknown substrateenergy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 199.6)
    Cellular processesCellular processesCell divisioncell division ATP-binding protein FtsE (TIGR02673; HMM-score: 197.3)
    ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 195.7)
    MetabolismTransport and binding proteinsUnknown substrateenergy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 194.9)
    Cellular processesCellular processesToxin production and resistanceputative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 189)
    MetabolismTransport and binding proteinsUnknown substrateputative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 189)
    2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 185.1)
    Genetic information processingProtein fateProtein and peptide secretion and traffickinglipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 182.7)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminespolyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 173.2)
    MetabolismTransport and binding proteinsCations and iron carrying compoundsnickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 162.3)
    MetabolismTransport and binding proteinsOtherdaunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 161.2)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminescholine ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 158.3)
    MetabolismTransport and binding proteinsAnionsnitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 157.1)
    MetabolismTransport and binding proteinsOthernitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 157.1)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesurea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 156.9)
    Cellular processesCellular processesBiosynthesis of natural productsNHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 155.6)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesNHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 155.6)
    Cellular processesCellular processesPathogenesistype I secretion system ATPase (TIGR03375; HMM-score: 149.2)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingtype I secretion system ATPase (TIGR03375; HMM-score: 149.2)
    MetabolismTransport and binding proteinsCations and iron carrying compoundscobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 148.3)
    MetabolismTransport and binding proteinsCations and iron carrying compoundsnickel import ATP-binding protein NikD (TIGR02770; HMM-score: 145.6)
    MetabolismTransport and binding proteinsOtherthiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 145.4)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingtype I secretion system ATPase (TIGR01846; HMM-score: 145.1)
    MetabolismTransport and binding proteinsAnionsmolybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 143.9)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesLPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 143.8)
    MetabolismTransport and binding proteinsOtherLPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 143.8)
    MetabolismEnergy metabolismMethanogenesismethyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 138.9)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharideslipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 138.2)
    MetabolismTransport and binding proteinsOtherlipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 138.2)
    thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 137.3)
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 133.8)
    MetabolismTransport and binding proteinsOtherantigen peptide transporter 2 (TIGR00958; HMM-score: 132.9)
    ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 132.1)
    Cellular processesCellular processesBiosynthesis of natural productsNHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 129.1)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesNHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 129.1)
    proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 128.5)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesurea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 125.1)
    thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 123.1)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingtype I secretion system ATPase (TIGR01842; HMM-score: 119)
    gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 115)
    MetabolismTransport and binding proteinsUnknown substrateanchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 114.9)
    lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 114.6)
    MetabolismTransport and binding proteinsOtherpigment precursor permease (TIGR00955; HMM-score: 111.5)
    Cellular processesCellular processesOthernodulation ABC transporter NodI (TIGR01288; HMM-score: 109.7)
    MetabolismTransport and binding proteinsOthernodulation ABC transporter NodI (TIGR01288; HMM-score: 109.7)
    phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 108.9)
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsD-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 106.8)
    MetabolismCentral intermediary metabolismPhosphorus compoundsphosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 106.5)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingABC-type bacteriocin transporter (TIGR01193; HMM-score: 106.2)
    Genetic information processingProtein fateProtein modification and repairABC-type bacteriocin transporter (TIGR01193; HMM-score: 106.2)
    MetabolismTransport and binding proteinsOtherABC-type bacteriocin transporter (TIGR01193; HMM-score: 106.2)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingheme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 102.8)
    MetabolismTransport and binding proteinsOtherheme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 102.8)
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsglucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 98.1)
    MetabolismTransport and binding proteinsOtherrim ABC transporter (TIGR01257; HMM-score: 94.1)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersOtherFeS assembly ATPase SufC (TIGR01978; HMM-score: 93.2)
    ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 92)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminescyclic peptide transporter (TIGR01194; HMM-score: 83.9)
    MetabolismTransport and binding proteinsOthercyclic peptide transporter (TIGR01194; HMM-score: 83.9)
    MetabolismTransport and binding proteinsOthermulti drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 76.2)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairexcinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 57.7)
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsperoxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 56)
    MetabolismTransport and binding proteinsOtherpleiotropic drug resistance family protein (TIGR00956; HMM-score: 50.1)
    MetabolismTransport and binding proteinsAnionscystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 48.6)
    rad50 (TIGR00606; HMM-score: 17)
    MetabolismCentral intermediary metabolismPhosphorus compoundsphosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN (TIGR02322; HMM-score: 15.7)
    Cellular processesCellular processesCell divisionchromosome segregation protein SMC (TIGR02168; HMM-score: 15.1)
    Genetic information processingDNA metabolismChromosome-associated proteinschromosome segregation protein SMC (TIGR02168; HMM-score: 15.1)
    KaiC domain protein, PAE1156 family (TIGR03881; HMM-score: 14)
    Unknown functionGeneralMg chelatase-like protein (TIGR00368; HMM-score: 13.1)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersMolybdopterinmolybdopterin-guanine dinucleotide biosynthesis protein B (TIGR00176; HMM-score: 12.9)
    Cell structureCell envelopeSurface structurestwitching motility protein (TIGR01420; HMM-score: 12.7)
    Cellular processesCellular processesChemotaxis and motilitytwitching motility protein (TIGR01420; HMM-score: 12.7)
    type IV secretion/conjugal transfer ATPase, VirB4 family (TIGR00929; HMM-score: 12.4)
  • TheSEED:  
    Glutamine ABC transporter, ATP-binding protein GlnQ 
  • PFAM:
    P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 133.3)
    AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 51.4)
    SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 43.9)
    AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 27.8)
    ABC_ATPase; Predicted ATPase of the ABC class (PF09818; HMM-score: 24.3)
    AAA_23; AAA domain (PF13476; HMM-score: 23.7)
    AAA_15; AAA ATPase domain (PF13175; HMM-score: 21.8)
    AAA_16; AAA ATPase domain (PF13191; HMM-score: 21.2)
    AAA_22; AAA domain (PF13401; HMM-score: 20)
    RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 18.8)
    AAA_30; AAA domain (PF13604; HMM-score: 16.3)
    AAA_13; AAA domain (PF13166; HMM-score: 15.8)
    AAA_18; AAA domain (PF13238; HMM-score: 15.7)
    ATPase_2; ATPase domain predominantly from Archaea (PF01637; HMM-score: 15.5)
    AAA_25; AAA domain (PF13481; HMM-score: 14.9)
    AAA_24; AAA domain (PF13479; HMM-score: 14.9)
    AAA_33; AAA domain (PF13671; HMM-score: 14.9)
    Mg_chelatase; Magnesium chelatase, subunit ChlI (PF01078; HMM-score: 14.3)
    Adeno_IVa2; Adenovirus IVa2 protein (PF02456; HMM-score: 14)
    MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 13.9)
    IstB_IS21; IstB-like ATP binding protein (PF01695; HMM-score: 13.7)
    SbcCD_C; Putative exonuclease SbcCD, C subunit (PF13558; HMM-score: 13.4)
    AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 13.3)
    G-alpha; G-protein alpha subunit (PF00503; HMM-score: 13)
    AAA_19; AAA domain (PF13245; HMM-score: 13)
    NACHT; NACHT domain (PF05729; HMM-score: 12.9)
    AAA_28; AAA domain (PF13521; HMM-score: 12.8)
    T2SSE; Type II/IV secretion system protein (PF00437; HMM-score: 12.4)
    Cytidylate_kin; Cytidylate kinase (PF02224; HMM-score: 12.4)
    NB-ARC; NB-ARC domain (PF00931; HMM-score: 11.9)
    CYTH (CL0273) Pox_ATPase-GT; mRNA capping enzyme N-terminal, ATPase and guanylyltransferase (PF10640; HMM-score: 11.6)

Structure, modifications & interactions[edit source | edit]

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 1.05
    • Cytoplasmic Membrane Score: 8.78
    • Cellwall Score: 0.08
    • Extracellular Score: 0.09
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.127
    • Ymax_pos: 15
    • Cmax: 0.123
    • Cmax_pos: 15
    • Smax: 0.173
    • Smax_pos: 11
    • Smean: 0.129
    • D: 0.128
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MPVIKINNLNKVFGDNEVLKDINLEINQGEVVAIIGPSGSGKSTLLRCMNLLEVPTKGQVIFEGNDLTEKGTQVDKLRQKMGMVFQNFNLFPHKKVVDNIILAPKLLKKDNNDELHKEALSLLDKVGLKEKADVYPNQLSGGQKQRVAIARALAMHPDVILFDEPTSALDPEVVGDVLKVMKDLAKEGMTMVVVTHEMGFAKDVSDKVIFMADGVVVESGTPVEIFEQPQHERTQNFLARVL

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulators: ArgR, CodY
    ArgR (TF) important in Arginine biosynthesis, Arginine degradation  RegPrecise    transcription unit transferred from N315 data RegPrecise
    CodY (TF) important in Amino acid metabolism  RegPrecise    transcription unit transferred from N315 data RegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.0 1.1 1.2 1.3 1.4 1.5 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]