From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_2189 [new locus tag: SAUSA300_RS12075 ]
  • pan locus tag?: SAUPAN005687000
  • symbol: rplF
  • pan gene symbol?: rplF
  • synonym:
  • product: 50S ribosomal protein L6

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAUSA300_2189 [new locus tag: SAUSA300_RS12075 ]
  • symbol: rplF
  • product: 50S ribosomal protein L6
  • replicon: chromosome
  • strand: -
  • coordinates: 2363719..2364255
  • length: 537
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGAGTCGTGTTGGTAAGAAAATTATTGACATCCCTAGTGACGTAACAGTAACTTTTGAT
    GGAAATCATGTAACTGTTAAAGGTCCTAAAGGTGAATTATCAAGAACTTTAAATGAAAGA
    ATGACATTCAAACAAGAAGAAAACACAATTGAAGTTGTAAGACCATCTGATTCTAAAGAA
    GATAGAACAAACCATGGTACAACTCGTGCTTTATTAAACAATATGGTACAAGGTGTTTCT
    CAAGGATACGTAAAAGTACTTGAACTTGTTGGTGTAGGTTACCGTGCTCAAATGCAAGGT
    AAAGACTTAATCCTTAACGTTGGTTATTCTCACCCAGTAGAAATTAAAGCTGAAGAAAAC
    ATTACTTTCTCAGTTGAGAAAAACACAGTCGTTAAAGTTGAAGGTATTTCAAAAGAACAA
    GTTGGAGCATTAGCATCTAACATCCGTTCAGTAAGACCTCCAGAGCCTTACAAAGGTAAA
    GGTATTCGTTACCAAGGTGAATACGTTCGCCGTAAAGAAGGTAAAACTGGTAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    537

Protein[edit source | edit]

Protein Data Bank: 5LI0
Protein Data Bank: 4WCE
Protein Data Bank: 4WFB
Protein Data Bank: 4WF9
Protein Data Bank: 4WFA
Protein Data Bank: 5HL7

General[edit source | edit]

  • locus tag: SAUSA300_2189 [new locus tag: SAUSA300_RS12075 ]
  • symbol: RplF
  • description: 50S ribosomal protein L6
  • length: 178
  • theoretical pI: 10.1171
  • theoretical MW: 19786.4
  • GRAVY: -0.635955

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingProtein synthesisRibosomal proteins: synthesis and modificationribosomal protein uL6 (TIGR03654; HMM-score: 247.2)
    Genetic information processingProtein synthesisRibosomal proteins: synthesis and modificationribosomal protein uL6 (TIGR03653; HMM-score: 79.7)
    Planctomycetes uncharacterized domain TIGR03000 (TIGR03000; HMM-score: 13.3)
  • TheSEED:  
    Protein MetabolismProtein biosynthesisRibosome LSU bacterial LSU ribosomal protein L6p (L9e) 
  • PFAM:
    no clan definedRibosomal_L6; Ribosomal protein L6 (PF00347; HMM-score: 147.7)
    RAB3GAP2_N; Rab3 GTPase-activating protein regulatory subunit N-terminus (PF14655; HMM-score: 11.9)

Structure, modifications & interactions[edit source | edit]

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.144
    • Ymax_pos: 21
    • Cmax: 0.119
    • Cmax_pos: 29
    • Smax: 0.251
    • Smax_pos: 16
    • Smean: 0.191
    • D: 0.162
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MSRVGKKIIDIPSDVTVTFDGNHVTVKGPKGELSRTLNERMTFKQEENTIEVVRPSDSKEDRTNHGTTRALLNNMVQGVSQGYVKVLELVGVGYRAQMQGKDLILNVGYSHPVEIKAEENITFSVEKNTVVKVEGISKEQVGALASNIRSVRPPEPYKGKGIRYQGEYVRRKEGKTGK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35 1.36 1.37 1.38 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]