From AureoWiki
Jump to: navigation, search

NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_0488 [new locus tag: SAUSA300_RS02620 ]
  • pan locus tag?: SAUPAN002251000
  • symbol: hpt
  • pan gene symbol?: hpt
  • synonym:
  • product: hypoxanthine phosphoribosyltransferase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAUSA300_0488 [new locus tag: SAUSA300_RS02620 ]
  • symbol: hpt
  • product: hypoxanthine phosphoribosyltransferase
  • replicon: chromosome
  • strand: +
  • coordinates: 546656..547207
  • length: 552
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGAATAGCGTTATGCATAATGATTTGAAAGAAGTATTGTTAACTGAAGAAGATATTCAA
    AATATCTGTAAGGAATTGGGAGCACAATTAACAAAGGATTATCAAGGTAAACCATTAGTA
    TGCGTGGGTATCTTAAAAGGCTCAGCAATGTTTATGTCAGATTTAATTAAACGAATTGAT
    ACCCATTTATCAATTGATTTCATGGATGTTTCTAGTTATCACGGAGGCACTGAGTCAACT
    GGTGAAGTTCAAATCATTAAAGATTTAGGTTCTTCTATTGAAAATAAAGACGTATTAATT
    ATTGAAGATATCTTAGAGACTGGTACTACACTTAAGTCAATTACTGAATTATTACAATCT
    AGAAAAGTTAATTCATTAGAAATAGTTACTTTATTAGATAAACCAAACCGTCGTAAAGCG
    GACATTGAAGCTAAGTATGTAGGTAAAAAAATACCAGATGAATTTGTTGTTGGTTACGGT
    TTAGATTATCGTGAATTATACCGAAACTTACCATATATCGGTACGTTAAAACCTGAAGTG
    TATTCAAATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    552

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAUSA300_0488 [new locus tag: SAUSA300_RS02620 ]
  • symbol: Hpt
  • description: hypoxanthine phosphoribosyltransferase
  • length: 183
  • theoretical pI: 4.80735
  • theoretical MW: 20585.5
  • GRAVY: -0.234426

Function[edit source | edit]

  • reaction:
    EC 2.4.2.8?  ExPASy
    Hypoxanthine phosphoribosyltransferaseIMP + diphosphate = hypoxanthine + 5-phospho-alpha-D-ribose 1-diphosphate
  • TIGRFAM:
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesSalvage of nucleosides and nucleotideshypoxanthine phosphoribosyltransferase (TIGR01203; EC 2.4.2.8; HMM-score: 216)
    and 9 more
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesSalvage of nucleosides and nucleotidesuracil phosphoribosyltransferase (TIGR01091; EC 2.4.2.9; HMM-score: 23.6)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPyrimidine ribonucleotide biosynthesisorotate phosphoribosyltransferase (TIGR00336; EC 2.4.2.10; HMM-score: 22)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPurine ribonucleotide biosynthesisribose-phosphate diphosphokinase (TIGR01251; EC 2.7.6.1; HMM-score: 19.9)
    Cellular processesCellular processesDNA transformationcomF family protein (TIGR00201; HMM-score: 19.2)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesSalvage of nucleosides and nucleotidesadenine phosphoribosyltransferase (TIGR01090; EC 2.4.2.7; HMM-score: 19.2)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPyrimidine ribonucleotide biosynthesisorotate phosphoribosyltransferase (TIGR01367; EC 2.4.2.10; HMM-score: 14.7)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPurine ribonucleotide biosynthesispur operon repressor PurR (TIGR01743; HMM-score: 14)
    Signal transductionRegulatory functionsDNA interactionspur operon repressor PurR (TIGR01743; HMM-score: 14)
    Genetic information processingTranscriptionRNA processingqueuine synthase (TIGR03138; EC 1.7.1.13; HMM-score: 12.2)
  • TheSEED:  
    Nucleosides and NucleotidesPurinesPurine conversions Hypoxanthine-guanine phosphoribosyltransferase (EC 2.4.2.8) 
    and 1 more
    Cell division-ribosomal stress proteins cluster Hypoxanthine-guanine phosphoribosyltransferase (EC 2.4.2.8) 
  • PFAM:
    PRTase-like (CL0533) Pribosyltran; Phosphoribosyl transferase domain (PF00156; HMM-score: 90.3)
    and 3 more
    UPRTase; Uracil phosphoribosyltransferase (PF14681; HMM-score: 19.3)
    P-loop_NTPase (CL0023) Helicase_C; Helicase conserved C-terminal domain (PF00271; HMM-score: 13.5)
    PRTase-like (CL0533) PRTase_2; Phosphoribosyl transferase (PF15609; HMM-score: 11.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: Mg2+
  • effectors:
  • protein partners:
    SAUSA300_2187(rpsE)30S ribosomal protein S5  [1] (data from MRSA252)
    SAUSA300_2171(rpsI)30S ribosomal protein S9  [1] (data from MRSA252)

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.109
    • Ymax_pos: 29
    • Cmax: 0.113
    • Cmax_pos: 59
    • Smax: 0.144
    • Smax_pos: 25
    • Smean: 0.101
    • D: 0.106
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MNSVMHNDLKEVLLTEEDIQNICKELGAQLTKDYQGKPLVCVGILKGSAMFMSDLIKRIDTHLSIDFMDVSSYHGGTESTGEVQIIKDLGSSIENKDVLIIEDILETGTTLKSITELLQSRKVNSLEIVTLLDKPNRRKADIEAKYVGKKIPDEFVVGYGLDYRELYRNLPYIGTLKPEVYSN

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.0 1.1 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]