From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_0472 [new locus tag: NWMN_RS02700 ]
  • pan locus tag?: SAUPAN002251000
  • symbol: hpt
  • pan gene symbol?: hpt
  • synonym:
  • product: hypoxanthine phosphoribosyltransferase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_0472 [new locus tag: NWMN_RS02700 ]
  • symbol: hpt
  • product: hypoxanthine phosphoribosyltransferase
  • replicon: chromosome
  • strand: +
  • coordinates: 536565..537080
  • length: 516
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    TTGTTAACTGAAGAAGATATTCAAAATATCTGTAAGGAATTGGGAGCACAATTAACAAAG
    GATTATCAAGGTAAACCATTAGTATGCGTGGGTATCTTAAAAGGCTCAGCAATGTTTATG
    TCAGATTTAATTAAACGAATTGATACCCATTTATCAATTGATTTCATGGATGTTTCTAGT
    TATCACGGAGGCACTGAGTCAACTGGTGAAGTTCAAATCATTAAAGATTTAGGTTCTTCT
    ATTGAAAATAAAGACGTATTAATTATTGAAGATATCTTAGAGACTGGTACTACACTTAAG
    TCAATTACTGAATTATTACAATCTAGAAAAGTTAATTCATTAGAAATAGTTACTTTATTA
    GATAAACCAAACCGTCGTAAAGCGGACATTGAAGCTAAGTATGTAGGTAAAAAAATACCA
    GATGAATTTGTTGTTGGTTACGGTTTAGATTATCGTGAATTATACCGAAACTTACCATAT
    ATCGGTACGTTAAAACCTGAAGTGTATTCAAATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    516

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_0472 [new locus tag: NWMN_RS02700 ]
  • symbol: Hpt
  • description: hypoxanthine phosphoribosyltransferase
  • length: 171
  • theoretical pI: 4.77462
  • theoretical MW: 19205
  • GRAVY: -0.227485

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesSalvage of nucleosides and nucleotideshypoxanthine phosphoribosyltransferase (TIGR01203; EC 2.4.2.8; HMM-score: 214.4)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesSalvage of nucleosides and nucleotidesuracil phosphoribosyltransferase (TIGR01091; EC 2.4.2.9; HMM-score: 22.9)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPyrimidine ribonucleotide biosynthesisorotate phosphoribosyltransferase (TIGR00336; EC 2.4.2.10; HMM-score: 21.9)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPurine ribonucleotide biosynthesisribose-phosphate diphosphokinase (TIGR01251; EC 2.7.6.1; HMM-score: 20)
    Cellular processesCellular processesDNA transformationcomF family protein (TIGR00201; HMM-score: 19.3)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesSalvage of nucleosides and nucleotidesadenine phosphoribosyltransferase (TIGR01090; EC 2.4.2.7; HMM-score: 19.1)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPurine ribonucleotide biosynthesispur operon repressor PurR (TIGR01743; HMM-score: 14.1)
    Signal transductionRegulatory functionsDNA interactionspur operon repressor PurR (TIGR01743; HMM-score: 14.1)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPyrimidine ribonucleotide biosynthesisorotate phosphoribosyltransferase (TIGR01367; EC 2.4.2.10; HMM-score: 13.4)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesSalvage of nucleosides and nucleotidesxanthine phosphoribosyltransferase (TIGR01744; EC 2.4.2.22; HMM-score: 12.6)
    Genetic information processingTranscriptionRNA processingqueuine synthase (TIGR03138; EC 1.7.1.13; HMM-score: 12.5)
  • TheSEED:  
    Nucleosides and NucleotidesPurinesPurine conversions Hypoxanthine-guanine phosphoribosyltransferase (EC 2.4.2.8) 
    Cell division-ribosomal stress proteins cluster Hypoxanthine-guanine phosphoribosyltransferase (EC 2.4.2.8) 
  • PFAM:
    PRTase-like (CL0533) Pribosyltran; Phosphoribosyl transferase domain (PF00156; HMM-score: 90.1)
    UPRTase; Uracil phosphoribosyltransferase (PF14681; HMM-score: 18.6)
    P-loop_NTPase (CL0023) Helicase_C; Helicase conserved C-terminal domain (PF00271; HMM-score: 13.7)
    PRTase-like (CL0533) PRTase_2; Phosphoribosyl transferase (PF15609; HMM-score: 11.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:
    NWMN_2135(rpsE)30S ribosomal protein S5  [1] (data from MRSA252)
    NWMN_2119(rpsI)30S ribosomal protein S9  [1] (data from MRSA252)

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.122
    • Ymax_pos: 47
    • Cmax: 0.121
    • Cmax_pos: 47
    • Smax: 0.147
    • Smax_pos: 44
    • Smean: 0.093
    • D: 0.111
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MLTEEDIQNICKELGAQLTKDYQGKPLVCVGILKGSAMFMSDLIKRIDTHLSIDFMDVSSYHGGTESTGEVQIIKDLGSSIENKDVLIIEDILETGTTLKSITELLQSRKVNSLEIVTLLDKPNRRKADIEAKYVGKKIPDEFVVGYGLDYRELYRNLPYIGTLKPEVYSN

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.0 1.1

Relevant publications[edit source | edit]