From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002251000
  • symbol?: hpt
  • description?: hypoxanthine phosphoribosyltransferase

      descriptions from strain specific annotations:

    • hypoxanthine phosphoribosyltransferase
    • hypoxanthine-guanine phosphoribosyltransferase
    • hypoxanthine-guanine phosphoribosyltransferase homologue
    • hypoxanthine-guanine phosphoribosyltransferase-like protein
    • putative hypoxanthine phosphoribosyltransferase
  • strand?: +
  • coordinates?: 2758389..2758946
  • synteny block?: BlockID0015500
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0554 (hpt)
    N315:
    NCTC8325:
    Newman:
    NWMN_0472 (hpt)
    USA300_FPR3757:
    04-02981:
    SA2981_0485
    08BA02176:
    C248_0566 (hpt)
    11819-97:
    MS7_0487 (hpt)
    71193:
    ST398NM01_0576
    ECT-R 2:
    ECTR2_450 (hpt)
    ED133:
    SAOV_0532
    ED98:
    SAAV_0457 (hpt)
    HO 5096 0412:
    SAEMRSA15_04360 (hpt)
    JH1:
    SaurJH1_0545
    JH9:
    SaurJH9_0532
    JKD6008:
    SAA6008_00515 (hpt)
    JKD6159:
    SAA6159_00461 (hpt)
    LGA251:
    SARLGA251_04440 (hpt)
    M013:
    M013TW_0482
    MRSA252:
    SAR0511 (hpt)
    MSHR1132:
    SAMSHR1132_04540
    MSSA476:
    SAS0467
    Mu3:
    SAHV_0507
    Mu50:
    SAV0510
    MW2:
    MW0465
    RF122:
    SAB0459 (hpt)
    ST398:
    SAPIG0576 (hpt)
    T0131:
    SAT0131_00556 (memE)
    TCH60:
    HMPREF0772_10009 (hpt)
    TW20:
    SATW20_05780 (hpt)
    USA300_TCH1516:
    USA300HOU_0504 (hpt)
    VC40:
    SAVC_02135

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ----MHNDLKEVLLTEEDIQNICKELGAQLTKDYQGKPLVCVGILKGSAMFMSDLIKRID
    N315            ----MHNDLKEVLLTEEDIQNICKELGAQLTKDYQGKPLVCVGILKGSAMFMSDLIKRID
    NCTC8325        ----MHNDLKEVLLTEEDIQNICKELGAQLTKDYQGKPLVCVGILKGSAMFMSDLIKRID
    Newman          ------------MLTEEDIQNICKELGAQLTKDYQGKPLVCVGILKGSAMFMSDLIKRID
    USA300_FPR3757  MNSVMHNDLKEVLLTEEDIQNICKELGAQLTKDYQGKPLVCVGILKGSAMFMSDLIKRID
                                :***********************************************

    COL             THLSIDFMDVSSYHGGTESTGEVQIIKDLGSSIENKDVLIIEDILETGTTLKSITELLQS
    N315            THLSIDFMDVSSYHGGTESTGEVQIIKDLGSSIENKDVLIIEDILETGTTLKSITELLQS
    NCTC8325        THLSIDFMDVSSYHGGTESTGEVQIIKDLGSSIENKDVLIIEDILETGTTLKSITELLQS
    Newman          THLSIDFMDVSSYHGGTESTGEVQIIKDLGSSIENKDVLIIEDILETGTTLKSITELLQS
    USA300_FPR3757  THLSIDFMDVSSYHGGTESTGEVQIIKDLGSSIENKDVLIIEDILETGTTLKSITELLQS
                    ************************************************************

    COL             RKVNSLEIVTLLDKPNRRKADIEAKYVGKKIPDEFVVGYGLDYRELYRNLPYIGTLKPEV
    N315            RKVNSLEIVTLLDKPNRRKADIEAKYVGKKIPDEFVVGYGLDYRELYRNLPYIGTLKPEV
    NCTC8325        RKVNSLEIVTLLDKPNRRKADIEAKYVGKKIPDEFVVGYGLDYRELYRNLPYIGTLKPEV
    Newman          RKVNSLEIVTLLDKPNRRKADIEAKYVGKKIPDEFVVGYGLDYRELYRNLPYIGTLKPEV
    USA300_FPR3757  RKVNSLEIVTLLDKPNRRKADIEAKYVGKKIPDEFVVGYGLDYRELYRNLPYIGTLKPEV
                    ************************************************************

    COL             YSN
    N315            YSN
    NCTC8325        YSN
    Newman          YSN
    USA300_FPR3757  YSN
                    ***