Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_2171 [new locus tag: SAUSA300_RS11985 ]
- pan locus tag?: SAUPAN005634000
- symbol: rpsI
- pan gene symbol?: rpsI
- synonym:
- product: 30S ribosomal protein S9
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_2171 [new locus tag: SAUSA300_RS11985 ]
- symbol: rpsI
- product: 30S ribosomal protein S9
- replicon: chromosome
- strand: -
- coordinates: 2352541..2352939
- length: 399
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3913018 NCBI
- RefSeq: YP_494806 NCBI
- BioCyc: GH3C-2158 BioCyc
- MicrobesOnline: 1293686 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGACTTTGGCACAAGTTGAATATAGAGGCACAGGCCGTCGTAAAAACTCAGTAGCACGT
GTACGTTTAGTACCAGGTGAAGGTAACATCACAGTTAATAACCGTGACGTACGCGAATAC
TTACCATTCGAATCATTAATTTTAGACTTAAACCAACCATTTGATGTAACTGAAACTAAA
GGTAACTATGATGTTTTAGTTAACGTTCATGGTGGTGGTTTCACTGGACAAGCTCAAGCT
ATCCGTCACGGAATCGCTCGTGCATTATTAGAAGCAGATCCTGAATACAGAGGTTCTTTA
AAACGCGCTGGATTACTTACTCGTGACCCACGTATGAAAGAACGTAAAAAACCAGGTCTT
AAAGCAGCTCGTCGTTCACCTCAATTCTCAAAACGTTAA60
120
180
240
300
360
399
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_2171 [new locus tag: SAUSA300_RS11985 ]
- symbol: RpsI
- description: 30S ribosomal protein S9
- length: 132
- theoretical pI: 11.1618
- theoretical MW: 14829.8
- GRAVY: -0.706061
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uS9 (TIGR03627; HMM-score: 70.2)
- TheSEED :
- SSU ribosomal protein S9p (S16e)
- PFAM: S5 (CL0329) Ribosomal_S9; Ribosomal protein S9/S16 (PF00380; HMM-score: 155.4)and 1 moreno clan defined DUF2135; Uncharacterized protein conserved in bacteria (DUF2135) (PF09906; HMM-score: 12.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.67
- Cytoplasmic Membrane Score: 0.01
- Cellwall Score: 0.15
- Extracellular Score: 0.17
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.006703
- TAT(Tat/SPI): 0.000253
- LIPO(Sec/SPII): 0.000676
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTLAQVEYRGTGRRKNSVARVRLVPGEGNITVNNRDVREYLPFESLILDLNQPFDVTETKGNYDVLVNVHGGGFTGQAQAIRHGIARALLEADPEYRGSLKRAGLLTRDPRMKERKKPGLKAARRSPQFSKR
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
SAUSA300_0760 (eno) phosphopyruvate hydratase [1] (data from MRSA252) SAUSA300_1362 (hup) DNA-binding protein HU [1] (data from MRSA252) SAUSA300_1251 (parC) DNA topoisomerase IV subunit A [1] (data from MRSA252) SAUSA300_2081 (pyrG) CTP synthetase [1] (data from MRSA252) SAUSA300_0523 (rplA) 50S ribosomal protein L1 [1] (data from MRSA252) SAUSA300_2201 (rplB) 50S ribosomal protein L2 [1] (data from MRSA252) SAUSA300_2203 (rplD) 50S ribosomal protein L4 [1] (data from MRSA252) SAUSA300_2192 (rplE) 50S ribosomal protein L5 [1] (data from MRSA252) SAUSA300_2189 (rplF) 50S ribosomal protein L6 [1] (data from MRSA252) SAUSA300_0524 (rplJ) 50S ribosomal protein L10 [1] (data from MRSA252) SAUSA300_0522 (rplK) 50S ribosomal protein L11 [1] (data from MRSA252) SAUSA300_0525 (rplL) 50S ribosomal protein L7/L12 [1] (data from MRSA252) SAUSA300_2185 (rplO) 50S ribosomal protein L15 [1] (data from MRSA252) SAUSA300_2197 (rplP) 50S ribosomal protein L16 [1] (data from MRSA252) SAUSA300_2177 (rplQ) 50S ribosomal protein L17 [1] (data from MRSA252) SAUSA300_1134 (rplS) 50S ribosomal protein L19 [1] (data from MRSA252) SAUSA300_1603 (rplU) 50S ribosomal protein L21 [1] (data from MRSA252) SAUSA300_2199 (rplV) 50S ribosomal protein L22 [1] (data from MRSA252) SAUSA300_2202 (rplW) 50S ribosomal protein L23 [1] (data from MRSA252) SAUSA300_1666 (rpsD) 30S ribosomal protein S4 [1] (data from MRSA252) SAUSA300_2187 (rpsE) 30S ribosomal protein S5 [1] (data from MRSA252) SAUSA300_0366 (rpsF) 30S ribosomal protein S6 [1] (data from MRSA252) SAUSA300_2179 (rpsK) 30S ribosomal protein S11 [1] (data from MRSA252) SAUSA300_2180 (rpsM) 30S ribosomal protein S13 [1] (data from MRSA252) SAUSA300_2195 (rpsQ) 30S ribosomal protein S17 [1] (data from MRSA252) SAUSA300_0307 5'-nucleotidase [1] (data from MRSA252) SAUSA300_0531 30S ribosomal protein S7 [1] (data from MRSA252) SAUSA300_0989 hypothetical protein [1] (data from MRSA252) SAUSA300_1652 hypothetical protein [1] (data from MRSA252) SAUSA300_2279 LysR family regulatory protein [1] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: L13 leader (transcription termination) regulon
L13 leader (RNA) important in Ribosome biogenesis; transcription unit transferred from N315 data RegPrecise
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)
⊟Relevant publications[edit | edit source]