From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004794000
  • symbol?:
  • description?: ABC transporter permease

      descriptions from strain specific annotations:

    • ABC transporter permease
    • amino acid ABC transporter permease/substrate-binding protein
    • glutamate ABC transporter permease
    • extracellular glutamine-binding protein
    • Glutamate ABC transporter, periplasmic glutamine-binding protein
    • polar amino acid ABC transporter, inner membrane subunit
    • putative extracellular glutamine-bindingprotein
    • amino ABC transporter, permease , 3-TM region, His/Glu/Gln/Arg/opine family domain protein
    • amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family domain protein
    • amino acid ABC superfamily ATP binding cassette transporter, membrane protein
    • amino acid ABC transporter ATP-binding protein
    • amino acid ABC transporter permease
    • amino acid ABC transporter substrate-binding protein
    • ArtQ
    • glutamine-binding periplasmic protein
    • polar amino acid ABC transporter inner membrane subunit
    • substrate-binding glutamine ABC transporter
  • strand?: -
  • coordinates?: 5001075..5002400
  • synteny block?: BlockID0037260
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1814
    08BA02176:
    C248_1902
    11819-97:
    MS7_1863
    71193:
    ST398NM01_1924
    ECT-R 2:
    ECTR2_1700
    ED133:
    SAOV_1855
    ED98:
    SAAV_1877
    HO 5096 0412:
    SAEMRSA15_17630
    JH1:
    SaurJH1_1946
    JH9:
    SaurJH9_1912
    JKD6008:
    SAA6008_01815
    JKD6159:
    SAA6159_01787
    LGA251:
    SARLGA251_17410
    M013:
    M013TW_1864
    MRSA252:
    SAR1949
    MSHR1132:
    SAMSHR1132_17040
    MSSA476:
    SAS1781
    Mu3:
    SAHV_1843
    Mu50:
    SAV1858
    MW2:
    MW1799
    RF122:
    SAB1792c
    ST398:
    SAPIG1924
    T0131:
    SAT0131_01978 (pepT)
    TCH60:
    HMPREF0772_11286
    TW20:
    SATW20_18520
    USA300_TCH1516:
    USA300HOU_1853
    VC40:
    SAVC_08540

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKCLIRFILVLGLLISSAMVYINPTAHAEQDQTWEKIKERGELRVGLSADYAPMEFEHTV
    N315            --------------------------------------------MGLSADYAPMEFEHTV
    NCTC8325        MKCLIRFILVLGLLISSAMVYINPTAHAEQDQTWEKIKERGELRVGLSADYAPMEFEHTV
    Newman          MKCLIRFILVLGLLISSAMVYINPTAHAEQDQTWEKIKERGELRVGLSADYAPMEFEHTV
    USA300_FPR3757  MKCLIRFILVLGLLISSAMVYINPTAHAEQDQTWEKIKERGELRVGLSADYAPMEFEHTV
                                                                :***************

    COL             NGKTEYAGVDIDLAKKIAKDNNLKLKIVNMSFDSLLGALKTGKIDIIISGMTSTPERKKQ
    N315            NGKTEYAGVDIDLAKKIAKDNNLKLKIVNMSFDSLLGALKTGKIDIIISGMTSTPERKKQ
    NCTC8325        NGKTEYAGVDIDLAKKIAKDNNLKLKIVNMSFDSLLGALKTGKIDIIISGMTSTPERKKQ
    Newman          NGKTEYAGVDIDLAKKIAKDNNLKLKIVNMSFDSLLGALKTGKIDIIISGMTSTPERKKQ
    USA300_FPR3757  NGKTEYAGVDIDLAKKIAKDNNLKLKIVNMSFDSLLGALKTGKIDIIISGMTSTPERKKQ
                    ************************************************************

    COL             VDFSDSYMMTKNIMLVKKDKVNEYKDIKDFNNKKVGAQKGTEQEKIAQTEIENASITSLS
    N315            VDFSDSYMMTKNIMLVKKDKVNEYKDIKDFNNKKVGAQKGTEQEKIAQTEIENASITSLS
    NCTC8325        VDFSDSYMMTKNIMLVKKDKVNEYKDIKDFNNKKVGAQKGTEQEKIAQTEIENASITSLS
    Newman          VDFSDSYMMTKNIMLVKKDKVNEYKDIKDFNNKKVGAQKGTEQEKIAQTEIENASITSLS
    USA300_FPR3757  VDFSDSYMMTKNIMLVKKDKVNEYKDIKDFNNKKVGAQKGTEQEKIAQTEIENASITSLS
                    ************************************************************

    COL             RLPDVILALKSGKVEGAVVEKPVAEAYLKQNPKLGISNVKFNEEEKDTVIAVPKDSPKLL
    N315            RLPDVILALKSGKVEGAVVEKPVAEAYLKQNPKLGISNVKFNEEEKDTVIAVPKDSPKLL
    NCTC8325        RLPDVILALKSGKVEGAVVEKPVAEAYLKQNPKLGISNVKFNEEEKDTVIAVPKDSPKLL
    Newman          RLPDVILALKSGKVEGAVVEKPVAEAYLKQNPKLGISNVKFNEEEKDTVIAVPKDSPKLL
    USA300_FPR3757  RLPDVILALKSGKVEGAVVEKPVAEAYLKQNPKLGISNVKFNEEEKDTVIAVPKDSPKLL
                    ************************************************************

    COL             SQINKTIKEVKDKGLIDKYMTNAANAMNDDSGFISKYGSFFLKGIKITILISLIGVALGS
    N315            SQINKTIKEVKDKGLIDKYMTNAANAMNDDSGFISKYGSFFLKGIKITILISLIGVALGS
    NCTC8325        SQINKTIKEVKDKGLIDKYMTNAANAMNDDSGFISKYGSFFLKGIKITILISLIGVALGS
    Newman          SQINKTIKEVKDKGLIDKYMTNAANAMNDDSGFISKYGSFFLKGIKITILISLIGVALGS
    USA300_FPR3757  SQINKTIKEVKDKGLIDKYMTNAANAMNDDSGFISKYGSFFLKGIKITILISLIGVALGS
                    ************************************************************

    COL             ILGAFVALMKLSKIKIISWIASIYIEILRGTPMLVQVFIVFFGITAALGLDISALVCGTI
    N315            ILGAFVALMKLSKIKIISWIASIYIEILRGTPMLVQVFIVFFGITAALGLDISALVCGTI
    NCTC8325        ILGAFVALMKLSKIKIISWIASIYIEILRGTPMLVQVFIVFFGITAALGLDISALVCGTI
    Newman          ILGAFVALMKLSKIKIISWIASIYIEILRGTPMLVQVFIVFFGITAALGLDISALVCGTI
    USA300_FPR3757  ILGAFVALMKLSKIKIISWIASIYIEILRGTPMLVQVFIVFFGITAALGLDISALVCGTI
                    ************************************************************

    COL             ALVINSSAYIAEIIRAGINAVDKGQMEAARSLGLNYRQTMKSVIMPQAIKNILPALGNEF
    N315            ALVINSSAYIAEIIRAGINAVDKGQMEAARSLGLNYRQTMKSVIMPQAIKNILPALGNEF
    NCTC8325        ALVINSSAYIAEIIRAGINAVDKGQMEAARSLGLNYRQTMKSVIMPQAIKNILPALGNEF
    Newman          ALVINSSAYIAEIIRAGINAVDKGQMEAARSLGLNYRQTMKSVIMPQAIKNILPALGNEF
    USA300_FPR3757  ALVINSSAYIAEIIRAGINAVDKGQMEAARSLGLNYRQTMKSVIMPQAIKNILPALGNEF
                    ************************************************************

    COL             VTLIKESSIVSTIGVGEIMFNAQVVQGISFDPFTPLIVAAALYFVLTFVLTRIMNMIEGR
    N315            VTLIKESSIVSTIGVGEIMFNAQVVQGISFDPFTPLLVAAALYFVLTFVLTRIMNMIEGR
    NCTC8325        VTLIKESSIVSTIGVGEIMFNAQVVQGISFDPFTPLIVAAALYFVLTFVLTRIMNMIEGR
    Newman          VTLIKESSIVSTIGVGEIMFNAQVVQGISFDPFTPLIVAAALYFVLTFVLTRIMNMIEGR
    USA300_FPR3757  VTLIKESSIVSTIGVGEIMFNAQVVQGISFDPFTPLIVAAALYFVLTFVLTRIMNMIEGR
                    ************************************:***********************

    COL             LNASD
    N315            LNASD
    NCTC8325        LNASD
    Newman          LNASD
    USA300_FPR3757  LNASD
                    *****