From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004897000
  • symbol?:
  • description?: exported protein

      descriptions from strain specific annotations:

    • exported protein
    • membrane associated protein
  • strand?: +
  • coordinates?: 5093338..5093613
  • synteny block?: BlockID0038030
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1838
    08BA02176:
    C248_1954
    11819-97:
    MS7_1917
    71193:
    ST398NM01_1975
    ECT-R 2:
    ECTR2_1753
    ED133:
    SAOV_1980
    ED98:
    SAAV_1947
    HO 5096 0412:
    SAEMRSA15_17890
    JH1:
    SaurJH1_1970
    JH9:
    SaurJH9_1936
    JKD6008:
    SAA6008_01902
    JKD6159:
    SAA6159_01813
    LGA251:
    SARLGA251_17640
    M013:
    M013TW_1918
    MRSA252:
    SAR1972
    MSHR1132:
    SAMSHR1132_17270
    MSSA476:
    SAS1804
    Mu3:
    SAHV_1867
    Mu50:
    SAV1882
    MW2:
    MW1822
    RF122:
    SAB1814
    ST398:
    SAPIG1975
    T0131:
    SAT0131_02006
    TCH60:
    HMPREF0772_11262
    TW20:
    SATW20_18760
    USA300_TCH1516:
    USA300HOU_1878
    VC40:
    SAVC_08665

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MENKFVPGILIGAVIGGAISLADKSTRQALVQSVKDAKNGNRTRKPSKVSKIKDEVLYWK
    N315            MENKFVPGILIGAVIGGAISLADKSTRQALVQSVKDAKNGNRTRKPSKVSKIKDEVLYWK
    NCTC8325        MENKFVPGILIGAVIGGAISLADKSTRQALVQSVKDAKNGNRTRKPSKVSKIKDEVLYWK
    Newman          MENKFVPGILIGAVIGGAISLADKSTRQALVQSVKDAKNGNRTRKPSKVSKIKDEVLYWK
    USA300_FPR3757  MENKFVPGILIGAVIGGAISLADKSTRQALVQSVKDAKNGNRTRKPSKVSKIKDEVLYWK
                    ************************************************************

    COL             DVVEEIRRNNPELERSLKDAKETFVNRKNQR
    N315            DVVEEIRRNNPELERSLKDAKETFVNRKNQR
    NCTC8325        DVVEEIRRNNPELERSLKDAKETFVNRKNQR
    Newman          DVVEEIRRNNPELERSLKDAKETFVNRKNQR
    USA300_FPR3757  DVVEEIRRNNPELERSLKDAKETFVNRKNQR
                    *******************************