From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004898000
  • symbol?:
  • description?: YihY/virulence factor BrkB family protein

      descriptions from strain specific annotations:

    • YihY/virulence factor BrkB family protein
    • ribonuclease BN
    • membrane protein
    • ribonuclease BN, putative
    • transporter
    • YihY family protein
  • strand?: +
  • coordinates?: 5093889..5095118
  • synteny block?: BlockID0038040
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1839
    08BA02176:
    C248_1955
    11819-97:
    MS7_1918 (yihY)
    71193:
    ST398NM01_1976
    ECT-R 2:
    ECTR2_1754 (yihY)
    ED133:
    SAOV_1981
    ED98:
    SAAV_1948
    HO 5096 0412:
    SAEMRSA15_17900
    JH1:
    SaurJH1_1971
    JH9:
    SaurJH9_1937
    JKD6008:
    SAA6008_01903
    JKD6159:
    SAA6159_01814
    LGA251:
    SARLGA251_17650
    M013:
    M013TW_1919
    MRSA252:
    SAR1973
    MSHR1132:
    SAMSHR1132_17280
    MSSA476:
    SAS1805
    Mu3:
    SAHV_1868
    Mu50:
    SAV1883
    MW2:
    MW1823
    RF122:
    SAB1815
    ST398:
    SAPIG1976
    T0131:
    SAT0131_02007 (ddh)
    TCH60:
    HMPREF0772_11261 (yihY)
    TW20:
    SATW20_18770
    USA300_TCH1516:
    USA300HOU_1879
    VC40:
    SAVC_08670

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSKKDHSSSKYLNSVKEAQEESKKKNKSNPKIDVDRTYIEPQQFQSKKPKKDDQVFFLSR
    N315            MSKKDHSSSKYLNSVKEAQEESKKKNKSNPKIDVDRTYIEPQQFQSKKPKKDDQVFFLSR
    NCTC8325        MSKKDHSSSKYLNSVKEAQEESKKKNKSNPKIDVDRTYIEPQQFQSKKPKKDDQVFFLSR
    Newman          MSKKDHSSSKYLNSVKEAQEESKKKNKSNPKIDVDRTYIEPQQFQSKKPKKDDQVFFLSR
    USA300_FPR3757  MSKKDHSSSKYLNSVKEAQEESKKKNKSNPKIDVDRTYIEPQQFQSKKPKKDDQVFFLSR
                    ************************************************************

    COL             LNKPAKYKKDSNFLSYLIYRIGKDDASGLAAQMTYHFVLAMFPMLLFLLTLLPFFNIKQS
    N315            LNKPAKYKKDSNFLSYLIYRIGKDDASGLAAQMTYHFVLAMFPMLLFLLTLLPFFNIKQS
    NCTC8325        LNKPAKYKKDSNFLSYLIYRIGKDDASGLAAQMTYHFVLAMFPMLLFLLTLLPFFNIKQS
    Newman          LNKPAKYKKDSNFLSYLIYRIGKDDASGLAAQMTYHFVLAMFPMLLFLLTLLPFFNIKQS
    USA300_FPR3757  LNKPAKYKKDSNFLSYLIYRIGKDDASGLAAQMTYHFVLAMFPMLLFLLTLLPFFNIKQS
                    ************************************************************

    COL             QITNMLSNAPAETSTLIKSVIGDITQNSSGGLLSIGLILAIWSASNGMTAIMNSFNVAYD
    N315            QITNMLSNAPAETSTLIKSVIGDITQNSSGGLLSIGLILAIWSASNGMTAIMNSFNVAYD
    NCTC8325        QITNMLSNAPAETSTLIKSVIGDITQNSSGGLLSIGLILAIWSASNGMTAIMNSFNVAYD
    Newman          QITNMLSNAPAETSTLIKSVIGDITQNSSGGLLSIGLILAIWSASNGMTAIMNSFNVAYD
    USA300_FPR3757  QITNMLSNAPAETSTLIKSVIGDITQNSSGGLLSIGLILAIWSASNGMTAIMNSFNVAYD
                    ************************************************************

    COL             VEDSRNGIVLKLLSVVFTVVMGVVFVVALALPTLGSVISHFLFGPLGFDEQVKWIFNLIR
    N315            VEDSRNGIVLKLLSVVFTVVMGVVFVVALALPTLGSVISHFLFGPLGFDEQVKWIFNLIR
    NCTC8325        VEDSRNGIVLKLLSVVFTVVMGVVFVVALALPTLGSVISHFLFGPLGFDEQVKWIFNLIR
    Newman          VEDSRNGIVLKLLSVVFTVVMGVVFVVALALPTLGSVISHFLFGPLGFDEQVKWIFNLIR
    USA300_FPR3757  VEDSRNGIVLKLLSVVFTVVMGVVFVVALALPTLGSVISHFLFGPLGFDEQVKWIFNLIR
                    ************************************************************

    COL             IVLPIIIIFIIFIVLYSVAPNVKTKLKSVLPGAVFTSIIWLAGSFGFGWYISNFGNYSKT
    N315            IVLPIIIIFIIFIVLYSVAPNVKTKLKSVLPGAVFTSIIWLAGSFGFGWYISNFGNYSKT
    NCTC8325        IVLPIIIIFIIFIVLYSVAPNVKTKLKSVLPGAVFTSIIWLAGSFGFGWYISNFGNYSKT
    Newman          IVLPIIIIFIIFIVLYSVAPNVKTKLKSVLPGAVFTSIIWLAGSFGFGWYISNFGNYSKT
    USA300_FPR3757  IVLPIIIIFIIFIVLYSVAPNVKTKLKSVLPGAVFTSIIWLAGSFGFGWYISNFGNYSKT
                    ************************************************************

    COL             YGSIAGIIILLLWLYITSFIIIVGAEINAIIHQRSVIKGKTPEEAALEHDDNNKNHYNEN
    N315            YGSIAGIIILLLWLYITSFIIIVGAEINAIIHQRSVIKGKTPEEAALEHDDNNKNHYNEN
    NCTC8325        YGSIAGIIILLLWLYITSFIIIVGAEINAIIHQRSVIKGKTPEEAALEHDDNNKNHYNEN
    Newman          YGSIAGIIILLLWLYITSFIIIVGAEINAIIHQRSVIKGKTPEEAALEHDDNNKNHYNEN
    USA300_FPR3757  YGSIAGIIILLLWLYITSFIIIVGAEINAIIHQRSVIKGKTPEEAALEHDDNNKNHYNEN
                    ************************************************************

    COL             TRYEYDDDSNATHQRTYHVDEHPSDTYPEDDKNIKDKIVDKLKKD
    N315            TRYEYDEDSNATHQRTYHVDEHPSDTYPEDDKNIKDKIVDKLKKD
    NCTC8325        TRYEYDEDSNATHQRTYHVDEHPSDTYPEDDKNIKDKIVDKLKKD
    Newman          TRYEYDEDSNATHQRTYHVDEHPSDTYPEDDKNIKDKIVDKLKKD
    USA300_FPR3757  TRYEYDEDSNATHQRTYHVDEHPSDTYPEDDKNIKDKIVDKLKKD
                    ******:**************************************