From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004900000
  • symbol?: vraS
  • description?: two-component sensor histidine kinase

      descriptions from strain specific annotations:

    • two-component sensor histidine kinase
    • sensor histidine kinase VraS
    • histidine kinase
    • Sensor protein vraS
    • histidine kinase sensor
    • histidine kinase sensor VraS
    • integral membrane sensor signal transduction histidine kinase
    • Two-component sensor histidine kinase, sensor protein vraS
    • Two-component sensor protein
  • strand?: -
  • coordinates?: 5095859..5096902
  • synteny block?: BlockID0038060
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1943 (vraS)
    N315:
    SA1701 (vraS)
    NCTC8325:
    Newman:
    NWMN_1823 (vraS)
    USA300_FPR3757:
    04-02981:
    SA2981_1841 (vraS)
    08BA02176:
    C248_1957 (vraS)
    11819-97:
    MS7_1920 (vraS)
    71193:
    ST398NM01_1978
    ECT-R 2:
    ECTR2_1756
    ED133:
    SAOV_1983 (vraS)
    ED98:
    SAAV_1950 (vraS)
    HO 5096 0412:
    SAEMRSA15_17920 (vraS)
    JH1:
    SaurJH1_1973
    JH9:
    SaurJH9_1939
    JKD6008:
    SAA6008_01905 (vraS)
    JKD6159:
    SAA6159_01816 (vraS)
    LGA251:
    SARLGA251_17670 (vraS)
    M013:
    M013TW_1921
    MRSA252:
    SAR1975 (vraS)
    MSHR1132:
    SAMSHR1132_17300
    MSSA476:
    SAS1807
    Mu3:
    SAHV_1870 (vraS)
    Mu50:
    SAV1885 (vraS)
    MW2:
    MW1825 (vraS)
    RF122:
    SAB1817c (vraS)
    ST398:
    SAPIG1978
    T0131:
    SAT0131_02009
    TCH60:
    HMPREF0772_11259 (vraS)
    TW20:
    SATW20_18790 (vraS)
    USA300_TCH1516:
    USA300HOU_1881 (vraS)
    VC40:
    SAVC_08680 (vraS)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNHYIRTIGSMLILVYSMLAAFLFIDKVFVNIIYFQGMFYTQIFGIPVFLFLNLIIILLC
    N315            MNHYIRTIGSMLILVYSMLAAFLFIDKVFVNIIYFQGMFYTQIFGIPVFLFLNLIIILLC
    NCTC8325        MNHYIRTIGSMLILVYSMLAAFLFIDKVFVNIIYFQGMFYTQIFGIPVFLFLNLIIILLC
    Newman          MNHYIRTIGSMLILVYSMLAAFLFIDKVFVNIIYFQGMFYTQIFGIPVFLFLNLIIILLC
    USA300_FPR3757  MNHYIRTIGSMLILVYSMLAAFLFIDKVFVNIIYFQGMFYTQIFGIPVFLFLNLIIILLC
                    ************************************************************

    COL             IIVGSVLAYKINQQNDWIKTQIERSMEGETVGINDQNIEIYSETLDLYHTLVPLNQELHK
    N315            IIVGSVLAYKINQQNDWIKTQIERSMEGETVGINDQNIEIYSETLDLYHTLVPLNQELHK
    NCTC8325        IIVGSVLAYKINQQNDWIKTQIERSMEGETVGINDQNIEIYSETLDLYHTLVPLNQELHK
    Newman          IIVGSVLAYKINQQNDWIKTQIERSMEGETVGINDQNIEIYSETLDLYHTLVPLNQELHK
    USA300_FPR3757  IIVGSVLAYKINQQNDWIKTQIERSMEGETVGINDQNIEIYSETLDLYHTLVPLNQELHK
                    ************************************************************

    COL             LRLKTQNLTNENYNINDVKVKKIIEDERQRLARELHDSVSQQLFAASMMLSAIKETKLEP
    N315            LRLKTQNLTNENYNINDVKVKKIIEDERQRLARELHDSVSQQLFAASMMLSAIKETKLEP
    NCTC8325        LRLKTQNLTNENYNINDVKVKKIIEDERQRLARELHDSVSQQLFAASMMLSAIKETKLEP
    Newman          LRLKTQNLTNENYNINDVKVKKIIEDERQRLARELHDSVSQQLFAASMMLSAIKETKLEP
    USA300_FPR3757  LRLKTQNLTNENYNINDVKVKKIIEDERQRLARELHDSVSQQLFAASMMLSAIKETKLEP
                    ************************************************************

    COL             PLDQQIPILEKMVQDSQLEMRALLLHLRPLGLKDKSLGEGIKDLVIDLQKKVPMKVVHEI
    N315            PLDQQIPILEKMVQDSQLEMRALLLHLRPLGLKDKSLGEGIKDLVIDLQKKVPMKVVHEI
    NCTC8325        PLDQQIPILEKMVQDSQLEMRALLLHLRPLGLKDKSLGEGIKDLVIDLQKKVPMKVVHEI
    Newman          PLDQQIPILEKMVQDSQLEMRALLLHLRPLGLKDKSLGEGIKDLVIDLQKKVPMKVVHEI
    USA300_FPR3757  PLDQQIPILEKMVQDSQLEMRALLLHLRPLGLKDKSLGEGIKDLVIDLQKKVPMKVVHEI
                    ************************************************************

    COL             QDFKVPKGIEDHLFRITQEAISNTLRHSNGTKVTVELFNKDDYLLLRIQDNGKGFNVDEK
    N315            QDFKVPKGIEDHLFRITQEAISNTLRHSNGTKVTVELFNKDDYLLLRIQDNGKGFNVDEK
    NCTC8325        QDFKVPKGIEDHLFRITQEAISNTLRHSNGTKVTVELFNKDDYLLLRIQDNGKGFNVDEK
    Newman          QDFKVPKGIEDHLFRITQEAISNTLRHSNGTKVTVELFNKDDYLLLRIQDNGKGFNVDEK
    USA300_FPR3757  QDFKVPKGIEDHLFRITQEAISNTLRHSNGTKVTVELFNKDDYLLLRIQDNGKGFNVDEK
                    ************************************************************

    COL             LEQSYGLKNMRERALEIGATFHIVSLPDSGTRIEVKAPLNKEDSYDD
    N315            LEQSYGLKNMRERALEIGATFHIVSLPDSGTRIEVKAPLNKEDSYDD
    NCTC8325        LEQSYGLKNMRERALEIGATFHIVSLPDSGTRIEVKAPLNKEDSYDD
    Newman          LEQSYGLKNMRERALEIGATFHIVSLPDSGTRIEVKAPLNKEDSYDD
    USA300_FPR3757  LEQSYGLKNMRERALEIGATFHIVSLPDSGTRIEVKAPLNKEDSYDD
                    ***********************************************