From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004922000
  • symbol?: dgkB
  • description?: diacylglycerol kinase

      descriptions from strain specific annotations:

    • diacylglycerol kinase
    • lipid kinase
    • putative lipid kinase
    • diacylglycerol kinase catalytic domain (presumed) family protein
    • diacylglycerol kinase family protein
    • lipid kinase YegS
    • transcription regulator
    • Transcription regulator (contains diacylglycerol kinase catalytic domain)
  • strand?: -
  • coordinates?: 5111386..5112333
  • synteny block?: BlockID0038280
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1854
    08BA02176:
    C248_1972
    11819-97:
    MS7_1933 (dagK)
    71193:
    ST398NM01_1991
    ECT-R 2:
    ECTR2_1769
    ED133:
    SAOV_1997
    ED98:
    SAAV_1964
    HO 5096 0412:
    SAEMRSA15_18050
    JH1:
    SaurJH1_1986
    JH9:
    SaurJH9_1952
    JKD6008:
    SAA6008_01918
    JKD6159:
    SAA6159_01829
    LGA251:
    SARLGA251_17800
    M013:
    M013TW_1934
    MRSA252:
    SAR1989
    MSHR1132:
    SAMSHR1132_17430
    MSSA476:
    SAS1820
    Mu3:
    SAHV_1883
    Mu50:
    SAV1898
    MW2:
    MW1839
    RF122:
    SAB1830c
    ST398:
    SAPIG1991
    T0131:
    SAT0131_02023 (pgk)
    TCH60:
    HMPREF0772_11245 (yegS)
    TW20:
    SATW20_18920
    USA300_TCH1516:
    USA300HOU_1897
    VC40:
    SAVC_08750

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRKRARIIYNPTSGKELFKRELPDALIKLEKAGYETSAYATEKIGDATLEAERAMHENYD
    N315            MRKRARIIYNPTSGKELFKRELPDALIKLEKAGYETSAYATEKIGDATLEAERAMHENYD
    NCTC8325        MRKRARIIYNPTSGKELFKRELPDALIKLEKAGYETSAYATEKIGDATLEAERAMHENYD
    Newman          MRKRARIIYNPTSGKELFKRELPDALIKLEKAGYETSAYATEKIGDATLEAERAMHENYD
    USA300_FPR3757  MRKRARIIYNPTSGKELFKRELPDALIKLEKAGYETSAYATEKIGDATLEAERAMHENYD
                    ************************************************************

    COL             VLIAAGGDGTLNEVVNGIAEKPNRPKLGVIPMGTVNDFGRALHIPNDIMGALDVIIEGHS
    N315            VLIAAGGDGTLNEVVNGIAEKPNRPKLGVIPMGTVNDFGRALHIPNDIMGALDVIIEGHS
    NCTC8325        VLIAAGGDGTLNEVVNGIAEKPNRPKLGVIPMGTVNDFGRALHIPNDIMGALDVIIEGHS
    Newman          VLIAAGGDGTLNEVVNGIAEKPNRPKLGVIPMGTVNDFGRALHIPNDIMGALDVIIEGHS
    USA300_FPR3757  VLIAAGGDGTLNEVVNGIAEKPNRPKLGVIPMGTVNDFGRALHIPNDIMGALDVIIEGHS
                    ************************************************************

    COL             TKVDIGKMNNRYFINLAAGGQLTQVSYETPSKLKSIVGPFAYYIKGFEMLPQMKAVDLRI
    N315            TKVDIGKMNNRYFINLAAGGQLTQVSYETPSKLKSIVGPFAYYIKGFEMLPQMKAVDLRI
    NCTC8325        TKVDIGKMNNRYFINLAAGGQLTQVSYETPSKLKSIVGPFAYYIKGFEMLPQMKAVDLRI
    Newman          TKVDIGKMNNRYFINLAAGGQLTQVSYETPSKLKSIVGPFAYYIKGFEMLPQMKAVDLRI
    USA300_FPR3757  TKVDIGKMNNRYFINLAAGGQLTQVSYETPSKLKSIVGPFAYYIKGFEMLPQMKAVDLRI
                    ************************************************************

    COL             EYDGNVFQGEALLFFLGLTNSMAGFEKLVPDAKLDDGYFTLIIVEKSNLAELGHIMTLAS
    N315            EYDGNVFQGEALLFFLGLTNSMAGFEKLVPDAKLDDGYFTLIIVEKSNLAELGHIMTLAS
    NCTC8325        EYDGNVFQGEALLFFLGLTNSMAGFEKLVPDAKLDDGYFTLIIVEKSNLAELGHIMTLAS
    Newman          EYDGNVFQGEALLFFLGLTNSMAGFEKLVPDAKLDDGYFTLIIVEKSNLAELGHIMTLAS
    USA300_FPR3757  EYDGNVFQGEALLFFLGLTNSMAGFEKLVPDAKLDDGYFTLIIVEKSNLAELGHIMTLAS
                    ************************************************************

    COL             RGEHTKHPKVIYEKAKAINISSFTDLQLNVDGEYGGKLPANFLNLERHIDVFAPNDIVNE
    N315            RGEHTKHPKVIYEKAKAINISSFTDLQLNVDGEYGGKLPANFLNLERHIDVFAPNDIVNE
    NCTC8325        RGEHTKHPKVIYEKAKAINISSFTDLQLNVDGEYGGKLPANFLNLERHIDVFAPNDIVNE
    Newman          RGEHTKHPKVIYEKAKAINISSFTDLQLNVDGEYGGKLPANFLNLERHIDVFAPNDIVNE
    USA300_FPR3757  RGEHTKHPKVIYEKAKAINISSFTDLQLNVDGEYGGKLPANFLNLERHIDVFAPNDIVNE
                    ************************************************************

    COL             ELINNDHVDDNLIEE
    N315            ELINNDHVDDNLIEE
    NCTC8325        ELINNDHVDDNLIEE
    Newman          ELINNDHVDDNLIEE
    USA300_FPR3757  ELINNDHVDDNLIEE
                    ***************