From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004927000
  • symbol?: gatA
  • description?: aspartyl/glutamyl-tRNA amidotransferase subunit A

      descriptions from strain specific annotations:

    • aspartyl/glutamyl-tRNA amidotransferase subunit A
    • glutamyl-tRNA(Gln) amidotransferase subunit A
    • aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit A
    • Aspartyl-tRNA(Asn) amidotransferase subunit A, Glutamyl-tRNA(Gln) amidotransferase subunit A
    • glutamyl-tRNA(Gln) amidotransferase subunit A (Glu-ADTsubunit A)
  • strand?: -
  • coordinates?: 5115062..5116519
  • synteny block?: BlockID0038330
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1961 (gatA)
    N315:
    SA1716 (gatA)
    NCTC8325:
    Newman:
    NWMN_1838 (gatA)
    USA300_FPR3757:
    04-02981:
    SA2981_1857
    08BA02176:
    C248_1975 (gatA)
    11819-97:
    MS7_1935 (gatA)
    71193:
    ST398NM01_1994
    ECT-R 2:
    ECTR2_1772 (gatA)
    ED133:
    SAOV_2000
    ED98:
    SAAV_1966 (gatA)
    HO 5096 0412:
    SAEMRSA15_18070 (gatA)
    JH1:
    SaurJH1_1989 (gatA)
    JH9:
    SaurJH9_1955 (gatA)
    JKD6008:
    SAA6008_01921 (gatA)
    JKD6159:
    SAA6159_01831 (gatA)
    LGA251:
    SARLGA251_17830 (gatA)
    M013:
    M013TW_1937
    MRSA252:
    SAR1992 (gatA)
    MSHR1132:
    SAMSHR1132_17450
    MSSA476:
    SAS1823 (gatA)
    Mu3:
    SAHV_1885 (gatA)
    Mu50:
    SAV1900 (gatA)
    MW2:
    MW1841 (gatA)
    RF122:
    SAB1833c (gatA)
    ST398:
    SAPIG1994
    T0131:
    SAT0131_02026 (eno)
    TCH60:
    HMPREF0772_11242 (gatA)
    TW20:
    SATW20_18950 (gatA)
    USA300_TCH1516:
    USA300HOU_1901 (gatA)
    VC40:
    SAVC_08760 (gatA)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSIRYESVENLLTLIKDKKIKPSDVVKDIYDAIEETDPTIKSFLALDKENAIKKAQELDE
    N315            MSIRYESVENLLTLIKDKKIKPSDVVKDIYDAIEETDPTIKSFLALDKENAIKKAQELDE
    NCTC8325        MSIRYESVENLLTLIKDKKIKPSDVVKDIYDAIEETDPTIKSFLALDKENAIKKAQELDE
    Newman          MSIRYESVENLLTLIKDKKIKPSDVVKDIYDAIEETDPTIKSFLALDKENAIKKAQELDE
    USA300_FPR3757  MSIRYESVENLLTLIKDKKIKPSDVVKDIYDAIEETDPTIKSFLALDKENAIKKAQELDE
                    ************************************************************

    COL             LQAKDQMDGKLFGIPMGIKDNIITNGLETTCASKMLEGFVPIYESTVMEKLHNENAVLIG
    N315            LQAKDQMDGKLFGIPMGIKDNIITNGLETTCASKMLEGFVPIYESTVMEKLHKENAVLIG
    NCTC8325        LQAKDQMDGKLFGIPMGIKDNIITNGLETTCASKMLEGFVPIYESTVMEKLHNENAVLIG
    Newman          LQAKDQMDGKLFGIPMGIKDNIITNGLETTCASKMLEGFVPIYESTVMEKLHNENAVLIG
    USA300_FPR3757  LQAKDQMDGKLFGIPMGIKDNIITNGLETTCASKMLEGFVPIYESTVMEKLHNENAVLIG
                    ****************************************************:*******

    COL             KLNMDEFAMGGSTETSYFKKTVNPFDHKAVPGGSSGGSAAAVAAGLVPFSLGSDTGGSIR
    N315            KLNMDEFAMGGSTETSYFKKTVNPFDHKAVPGGSSGGSAAAVAAGLVPLSLGSDTGGSIR
    NCTC8325        KLNMDEFAMGGSTETSYFKKTVNPFDHKAVPGGSSGGSAAAVAAGLVPFSLGSDTGGSIR
    Newman          KLNMDEFAMGGSTETSYFKKTVNPFDHKAVPGGSSGGSAAAVAAGLVPFSLGSDTGGSIR
    USA300_FPR3757  KLNMDEFAMGGSTETSYFKKTVNPFDHKAVPGGSSGGSAAAVAAGLVPFSLGSDTGGSIR
                    ************************************************:***********

    COL             QPAAYCGVVGMKPTYGRVSRFGLVAFASSLDQIGPLTRNVKDNAIVLEAISGADVNDSTS
    N315            QPAAYCGVVGMKPTYGRVSRFGLVAFASSLDQIGPLTRNVKDNAIVLEAISGADVNDSTS
    NCTC8325        QPAAYCGVVGMKPTYGRVSRFGLVAFASSLDQIGPLTRNVKDNAIVLEAISGADVNDSTS
    Newman          QPAAYCGVVGMKPTYGRVSRFGLVAFASSLDQIGPLTRNVKDNAIVLEAISGADVNDSTS
    USA300_FPR3757  QPAAYCGVVGMKPTYGRVSRFGLVAFASSLDQIGPLTRNVKDNAIVLEAISGADVNDSTS
                    ************************************************************

    COL             APVDDVDFTSEIGKDIKGLKVALPKEYLGEGVADDVKEAVQNAVETLKSLGAVVEEVSLP
    N315            APVDDVDFTSEIGKDIKGLKVALPKEYLGEGVADDVKEAVQNAVETLKSLGAVVEEVSLP
    NCTC8325        APVDDVDFTSEIGKDIKGLKVALPKEYLGEGVADDVKEAVQNAVETLKSLGAVVEEVSLP
    Newman          APVDDVDFTSEIGKDIKGLKVALPKEYLGEGVADDVKEAVQNAVETLKSLGAVVEEVSLP
    USA300_FPR3757  APVDDVDFTSEIGKDIKGLKVALPKEYLGEGVADDVKEAVQNAVETLKSLGAVVEEVSLP
                    ************************************************************

    COL             NTKFGIPSYYVIASSEASSNLSRFDGIRYGYHSKEAHSLEELYKMSRSEGFGKEVKRRIF
    N315            NTKFGIPSYYVIASSEASSNLSRFDGIRYGYHSKEAHSLEELYKMSRSEGFGKEVKRRIF
    NCTC8325        NTKFGIPSYYVIASSEASSNLSRFDGIRYGYHSKEAHSLEELYKMSRSEGFGKEVKRRIF
    Newman          NTKFGIPSYYVIASSEASSNLSRFDGIRYGYHSKEAHSLEELYKMSRSEGFGKEVKRRIF
    USA300_FPR3757  NTKFGIPSYYVIASSEASSNLSRFDGIRYGYHSKEAHSLEELYKMSRSEGFGKEVKRRIF
                    ************************************************************

    COL             LGTFALSSGYYDAYYKKSQKVRTLIKNDFDKVFENYDVVVGPTAPTTAFNLGEEIDDPLT
    N315            LGTFALSSGYYDAYYKKSQKVRTLIKNDFDKVFENYDVVVGPTAPTTAFNLGEEIDDPLT
    NCTC8325        LGTFALSSGYYDAYYKKSQKVRTLIKNDFDKVFENYDVVVGPTAPTTAFNLGEEIDDPLT
    Newman          LGTFALSSGYYDAYYKKSQKVRTLIKNDFDKVFENYDVVVGPTAPTTAFNLGEEIDDPLT
    USA300_FPR3757  LGTFALSSGYYDAYYKKSQKVRTLIKNDFDKVFENYDVVVGPTAPTTAFNLGEEIDDPLT
                    ************************************************************

    COL             MYANDLLTTPVNLAGLPGISVPCGQSNGRPIGLQFIGKPFDEKTLYRVAYQYETQYNLHD
    N315            MYANDLLTTPVNLAGLPGISVPCGQSNGRPIGLQFIGKPFDEKTLYRVAYQYETQYNLHD
    NCTC8325        MYANDLLTTPVNLAGLPGISVPCGQSNGRPIGLQFIGKPFDEKTLYRVAYQYETQYNLHD
    Newman          MYANDLLTTPVNLAGLPGISVPCGQSNGRPIGLQFIGKPFDEKTLYRVAYQYETQYNLHD
    USA300_FPR3757  MYANDLLTTPVNLAGLPGISVPCGQSNGRPIGLQFIGKPFDEKTLYRVAYQYETQYNLHD
                    ************************************************************

    COL             VYEKL
    N315            VYEKL
    NCTC8325        VYEKL
    Newman          VYEKL
    USA300_FPR3757  VYEKL
                    *****