From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004946000
  • symbol?:
  • description?: nicotinate phosphoribosyltransferase

      descriptions from strain specific annotations:

    • nicotinate phosphoribosyltransferase
    • nicotinate phosphoribosyltransferase (NAPRTase) family protein
    • putative nicotinate phosphoribosyltransferase
  • strand?: -
  • coordinates?: 5134738..5136180
  • synteny block?: BlockID0038500
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_1851 (nadC)
    USA300_FPR3757:
    04-02981:
    SA2981_1870
    08BA02176:
    C248_1989
    11819-97:
    MS7_1948
    71193:
    ST398NM01_2008
    ECT-R 2:
    ECTR2_1785
    ED133:
    SAOV_2016
    ED98:
    SAAV_1980
    HO 5096 0412:
    SAEMRSA15_18230
    JH1:
    SaurJH1_2003
    JH9:
    SaurJH9_1969
    JKD6008:
    SAA6008_01934 (nadC)
    JKD6159:
    SAA6159_01845 (nadC)
    LGA251:
    SARLGA251_17980
    M013:
    M013TW_1950
    MRSA252:
    SAR2006
    MSHR1132:
    SAMSHR1132_17580
    MSSA476:
    SAS1837
    Mu3:
    SAHV_1898
    Mu50:
    SAV1913
    MW2:
    MW1854
    RF122:
    SAB1850c
    ST398:
    SAPIG2008 (pncB)
    T0131:
    SAT0131_02041
    TCH60:
    HMPREF0772_11228
    TW20:
    SATW20_19080
    USA300_TCH1516:
    USA300HOU_1915
    VC40:
    SAVC_08830

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MYQLEDDSLMLHNDLYQINMAESYWNDNIHEKMAVFDLYFRKMPFNSGYAVFNGLKRVID
    N315            MYQLEDDSLMLHNDLYQINMAESYWNDNIHEKMAVFDLYFRKMPFNSGYAVFNGLKRVID
    NCTC8325        MYQLEDDSLMLHNDLYQINMAESYWNDNIHEKMAVFDLYFRKMPFNSGYAVFNGLKRVID
    Newman          MYQLEDDSLMLHNDLYQINMAESYWNDNIHEKMAVFDLYFRKMPFNSGYAVFNGLKRVID
    USA300_FPR3757  MYQLEDDSLMLHNDLYQINMAESYWNDNIHEKMAVFDLYFRKMPFNSGYAVFNGLKRVID
                    ************************************************************

    COL             FIEHFGFSESDLEYLKSIGYKDDFLSYLKDLKFTGSIRSMQEGELCFGNEPLLRVEAPLI
    N315            FIEHFGFSESDLEYLKSIGYKDDFLSYLKDLKFTGSIRSMQEGELCFGNEPLLRVEAPLI
    NCTC8325        FIEHFGFSESDLEYLKSIGYKDDFLSYLKDLKFTGSIRSMQEGELCFGNEPLLRVEAPLI
    Newman          FIEHFGFSESDLEYLKSIGYKDDFLSYLKDLKFTGSIRSMQEGELCFGNEPLLRVEAPLI
    USA300_FPR3757  FIEHFGFSESDLEYLKSIGYKDDFLSYLKDLKFTGSIRSMQEGELCFGNEPLLRVEAPLI
                    ************************************************************

    COL             QAQLIETILLNIVNFHTLITTKASRIRQIASNDKLMEFGTRRAQEIDAALWGARAAYIGG
    N315            QAQLIETILLNIVNFHTLITTKASRIRQIASNDKLMEFGTRRAQEIDAALWGARAAYIGG
    NCTC8325        QAQLIETILLNIVNFHTLITTKASRIRQIASNDKLMEFGTRRAQEIDAALWGARAAYIGG
    Newman          QAQLIETILLNIVNFHTLITTKASRIRQIASNDKLMEFGTRRAQEIDAALWGARAAYIGG
    USA300_FPR3757  QAQLIETILLNIVNFHTLITTKASRIRQIASNDKLMEFGTRRAQEIDAALWGARAAYIGG
                    ************************************************************

    COL             FDSTSNVRAGKLFGIPVSGTHAHAFVQTYGDEYVAFKKYAERHKNCVFLVDTFHTLKSGV
    N315            FDSTSNVRAGKLFGIPVSGTHAHAFVQTYGDEYVAFKKYAERHKNCVFLVDTFHTLKSGV
    NCTC8325        FDSTSNVRAGKLFGIPVSGTHAHAFVQTYGDEYVAFKKYAERHKNCVFLVDTFHTLKSGV
    Newman          FDSTSNVRAGKLFGIPVSGTHAHAFVQTYGDEYVAFKKYAERHKNCVFLVDTFHTLKSGV
    USA300_FPR3757  FDSTSNVRAGKLFGIPVSGTHAHAFVQTYGDEYVAFKKYAERHKNCVFLVDTFHTLKSGV
                    ************************************************************

    COL             PNAIKVAKELGDKINFVGIRLDSGDIAYLSKEARRMLDEAGFTETKIIASNDLDEETITS
    N315            PNAIKVAKELGDKINFVGIRLDSGDIAYLSKEARRMLDEAGFTETKIIASNDLDEETITS
    NCTC8325        PNAIKVAKELGDKINFVGIRLDSGDIAYLSKEARRMLDEAGFTETKIIASNDLDEETITS
    Newman          PNAIKVAKELGDKINFVGIRLDSGDIAYLSKEARRMLDEAGFTETKIIASNDLDEETITS
    USA300_FPR3757  PNAIKVAKELGDKINFVGIRLDSGDIAYLSKEARRMLDEAGFTETKIIASNDLDEETITS
                    ************************************************************

    COL             LKAQGAKVDSWGVGTKLITGYDQPALGAVYKLVAIENEDGSYSDRIKLSNNAEKVTTPGK
    N315            LKAQGAKVDSWGVGTKLITGYDQPALGAVYKLVAIENEEGSYSDRIKLSNNAEKVTTPGK
    NCTC8325        LKAQGAKVDSWGVGTKLITGYDQPALGAVYKLVAIENEDGSYSDRIKLSNNAEKVTTPGK
    Newman          LKAQGAKVDSWGVGTKLITGYDQPALGAVYKLVAIENEDGSYSDRIKLSNNAEKVTTPGK
    USA300_FPR3757  LKAQGAKVDSWGVGTKLITGYDQPALGAVYKLVAIENEDGSYSDRIKLSNNAEKVTTPGK
                    **************************************:*********************

    COL             KNVYRIINKKTGKAEGDYITLENENPYDEQPLKLFHPVHTYKMKFIKSFEAIDLHHNIYE
    N315            KNVYRIINKKTGKAEGDYITLENENPYDEQPLKLFHPVHTYKMKFIKSFEAIDLHHNIYE
    NCTC8325        KNVYRIINKKTGKAEGDYITLENENPYDEQPLKLFHPVHTYKMKFIKSFEAIDLHHNIYE
    Newman          KNVYRIINKKTGKAEGDYITLENENPYDEQPLKLFHPVHTYKMKFIKSFEAIDLHHNIYE
    USA300_FPR3757  KNVYRIINKKTGKAEGDYITLENENPYDEQPLKLFHPVHTYKMKFIKSFEAIDLHHNIYE
                    ************************************************************

    COL             NGKLVYQMPTEDESREYLALGLQSIWDENKRFLNPQEYPVDLSKACWDNKHKRIFEVAEH
    N315            NGKLVYQMPTEDESREYLAQGLQSIWDENKRFLNPQEYPVDLSKACWDNKHKRIFEVAEH
    NCTC8325        NGKLVYQMPTEDESREYLALGLQSIWDENKRFLNPQEYPVDLSKACWDNKHKRIFEVAEH
    Newman          NGKLVYQMPTEDESREYLALGLQSIWDENKRFLNPQEYPVDLSKACWDNKHKRIFEVAEH
    USA300_FPR3757  NGKLVYQMPTEDESREYLALGLQSIWDENKRFLNPQEYPVDLSKACWDNKHKRIFEVAEH
                    ******************* ****************************************

    COL             VKEMEEDNE
    N315            VKEMEEDNE
    NCTC8325        VKEMEEDNE
    Newman          VKEMEEDNE
    USA300_FPR3757  VKEMEEDNE
                    *********