From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004948000
  • symbol?: pheA
  • description?: prephenate dehydratase

      descriptions from strain specific annotations:

    • prephenate dehydratase
    • ACT domain protein
    • chorismate mutase
    • prephenate dehydratase family protein
    • putative prephenate dehydratase
  • strand?: +
  • coordinates?: 5137487..5138281
  • synteny block?: BlockID0038520
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1977 (pheA)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1872 (pheA)
    08BA02176:
    C248_1991
    11819-97:
    MS7_1950
    71193:
    ST398NM01_2010
    ECT-R 2:
    ECTR2_1787
    ED133:
    SAOV_2018
    ED98:
    SAAV_1982 (pheA)
    HO 5096 0412:
    SAEMRSA15_18250
    JH1:
    SaurJH1_2005
    JH9:
    SaurJH9_1971
    JKD6008:
    SAA6008_01936 (pheA)
    JKD6159:
    SAA6159_01847 (pheA)
    LGA251:
    SARLGA251_18000
    M013:
    M013TW_1952
    MRSA252:
    SAR2008
    MSHR1132:
    SAMSHR1132_17600
    MSSA476:
    SAS1839
    Mu3:
    SAHV_1900
    Mu50:
    SAV1915
    MW2:
    MW1856
    RF122:
    SAB1852
    ST398:
    SAPIG2010
    T0131:
    SAT0131_02043
    TCH60:
    HMPREF0772_11226 (pheA)
    TW20:
    SATW20_19100
    USA300_TCH1516:
    USA300HOU_1917 (pheA)
    VC40:
    SAVC_08840

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MQLYYLGPKGTFSYLACRQYFSENEATFQPKSNFFEVIKAVADDDTSIGVVPIENSIEGT
    N315            MQLYYLGPKGTFSYLACRQYFSENEATFQPKSNLFEVIKAVADDDTSIGVVPIENSIEGT
    NCTC8325        MQLYYLGPKGTFSYLACRQYFSENEATFQPKSNLFEVIKAVADDDTSIGVVPIENSIEGT
    Newman          MQLYYLGPKGTFSYLACRQYFSENEATFQPKSNFFEVIKAVADDDTSIGVVPIENSIEGT
    USA300_FPR3757  MQLYYLGPKGTFSYLACRQYFSENEATFQPKSNFFEVIKAVADDDTSIGVVPIENSIEGT
                    *********************************:**************************

    COL             INIVADALAQQDVFAHGEIRLDINFALYGNGTDSISDIKKVYSIAPAISQTTNYIHQHQF
    N315            INIVADALAQQDVFAHGEIRLDINFALYGNGTDSISDIKKVYSIAPAISQTTNYIHQHQF
    NCTC8325        INIVADALAQQDVFAHGEIRLDINFALYGNGTDSISDIKKVYSIAPAISQTTNYIHQHQF
    Newman          INIVADALAQQDVFAHGEIRLDINFALYGNGTDSISDIKKVYSIAPAISQTTNYIHQHQF
    USA300_FPR3757  INIVADALAQQDVFAHGEIRLDINFALYGNGTDSISDIKKVYSIAPAISQTTNYIHQHQF
                    ************************************************************

    COL             DYDYVDSTIQSLTKIENGVAAIAPLGSGEAYGFTPIDTHIEDYPHNVTRFLVIKNQQQFD
    N315            DYDYVDSTIQSLTKIENGVAAIAPLGSGEAYGFTPIDTHIEDYPHNVTRFLVIKNQQQFD
    NCTC8325        DYDYVDSTIQSLTKIENGVAAIAPLGSGEAYGFTPIDTHIEDYPHNVTRFLVIKNQQQFD
    Newman          DYDYVDSTIQSLTKIENGVAAIAPLGSGEAYGFTPIDTHIEDYPHNVTRFLVIKNQQQFD
    USA300_FPR3757  DYDYVDSTIQSLTKIENGVAAIAPLGSGEAYGFTPIDTHIEDYPHNVTRFLVIKNQQQFD
                    ************************************************************

    COL             QNATSLMFLITPMHDKPGLLASVLNTFALFNINLSWIESRPLKTQLGMYRFFVQADSAIT
    N315            QNATSLMFLITPMHDKPGLLASVLNTFALFNINLSWIESRPLKTQLGMYRFFVQADSAIT
    NCTC8325        QNATSLMFLITPMHDKPGLLASVLNTFALFNINLSWIESRPLKTQLGMYRFFVQADSAIT
    Newman          QNATSLMFLITPMHDKPGLLASVLNTFALFNINLSWIESRPLKTQLGMYRFFVQADSAIT
    USA300_FPR3757  QNATSLMFLITPMHDKPGLLASVLNTFALFNINLSWIESRPLKTQLGMYRFFVQADSAIT
                    ************************************************************

    COL             TDIKKVIAILETLDFKVEMIGAFN
    N315            TDIKKVIAILETLDFKVEMIGAFN
    NCTC8325        TDIKKVIAILETLDFKVEMIGAFN
    Newman          TDIKKVIAILETLDFKVEMIGAFN
    USA300_FPR3757  TDIKKVIAILETLDFKVEMIGAFN
                    ************************