From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004951000
  • symbol?: sdcS
  • description?: sodium-dependent transporter

      descriptions from strain specific annotations:

    • sodium-dependent transporter
    • anion transporter
    • sodium-dependent transporter (huNaDC-1), putative
    • transporter, divalent anion:Na+ symporter (DASS) family protein
    • sodium-dependent dicarboxylate transporter sdcS
    • sodium:sulfate symporter
    • putative sodium:sulfate symporter
    • DASS family divalent anion:sodium (Na+) symporter
    • sodium-dependent dicarboxylate transporter SdcS (Na(+)/dicarboxylatesymporter)
    • sodium-sulfate symport protein
  • strand?: -
  • coordinates?: 5138479..5140041
  • synteny block?: BlockID0038550
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1873
    08BA02176:
    C248_1993
    11819-97:
    MS7_1951 (sdcS)
    71193:
    ST398NM01_2011
    ECT-R 2:
    ECTR2_1788
    ED133:
    SAOV_2019
    ED98:
    SAAV_1983
    HO 5096 0412:
    SAEMRSA15_18260
    JH1:
    SaurJH1_2006
    JH9:
    SaurJH9_1972
    JKD6008:
    SAA6008_01937
    JKD6159:
    SAA6159_01848
    LGA251:
    SARLGA251_18010
    M013:
    M013TW_1953
    MRSA252:
    SAR2009
    MSHR1132:
    SAMSHR1132_17610
    MSSA476:
    SAS1840
    Mu3:
    SAHV_1901
    Mu50:
    SAV1916
    MW2:
    MW1857
    RF122:
    SAB1853c
    ST398:
    SAPIG2011
    T0131:
    SAT0131_02045
    TCH60:
    HMPREF0772_11225
    TW20:
    SATW20_19110
    USA300_TCH1516:
    USA300HOU_1918
    VC40:
    SAVC_08845

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAYFNQHQSMISKRYLTFFSKSKKKKPFSAGQLIGLILGPLLFLLTLLFFHPQDLPWKGV
    N315            MAYFNQHQSMISKRYLTFFSKSKKKKPFSAGQLIGLILGPLLFLLTLLFFHPQDLPWKGV
    NCTC8325        MAYFNQHQSMISKRYLTFFSKSKKKKPFSAGQLIGLILGPLLFLLTLLFFHPQDLPWKGV
    Newman          MAYFNQHQSMISKRYLTFFSKSKKKKPFSAGQLIGLILGPLLFLLTLLFFHPQDLPWKGV
    USA300_FPR3757  MAYFNQHQSMISKRYLTFFSKSKKKKPFSAGQLIGLILGPLLFLLTLLFFHPQDLPWKGV
                    ************************************************************

    COL             YVLAITLWIATWWITEAIPIAATSLLPIVLLPLGHILTPEQVSSEYGNDIIFLFLGGFIL
    N315            YVLAITLWIATWWITEAIPIAATSLLPIVLLPLGHILTPEQVSSEYGNDIIFLFLGGFIL
    NCTC8325        YVLAITLWIATWWITEAIPIAATSLLPIVLLPLGHILTPEQVSSEYGNDIIFLFLGGFIL
    Newman          YVLAITLWIATWWITEAIPIAATSLLPIVLLPLGHILTPEQVSSEYGNDIIFLFLGGFIL
    USA300_FPR3757  YVLAITLWIATWWITEAIPIAATSLLPIVLLPLGHILTPEQVSSEYGNDIIFLFLGGFIL
                    ************************************************************

    COL             AIAMERWNLHTRVALTIINLIGASTSKILLGFMVATGFLSMFVSNTAAVMIMIPIGLAII
    N315            AIAMERWNLHTRVALTIINLIGASTSKILLGFMVATGFLSMFVSNTAAVMIMIPIGLAII
    NCTC8325        AIAMERWNLHTRVALTIINLIGASTSKILLGFMVATGFLSMFVSNTAAVMIMIPIGLAII
    Newman          AIAMERWNLHTRVALTIINLIGASTSKILLGFMVATGFLSMFVSNTAAVMIMIPIGLAII
    USA300_FPR3757  AIAMERWNLHTRVALTIINLIGASTSKILLGFMVATGFLSMFVSNTAAVMIMIPIGLAII
                    ************************************************************

    COL             KEAHDLQEANTNQTSIQKFEKSLVLAIGYAGTIGGLGTLIGTPPLIILKGQYMQHFGHEI
    N315            KEAHDLQEANTNQTSIQKFEKSLVLAIGYAGTIGGLGTLIGTPPLIILKGQYMQHFGHEI
    NCTC8325        KEAHDLQEANTNQTSIQKFEKSLVLAIGYAGTIGGLGTLIGTPPLIILKGQYMQHFGHEI
    Newman          KEAHDLQEANTNQTSIQKFEKSLVLAIGYAGTIGGLGTLIGTPPLIILKGQYMQHFGHEI
    USA300_FPR3757  KEAHDLQEANTNQTSIQKFEKSLVLAIGYAGTIGGLGTLIGTPPLIILKGQYMQHFGYEI
                    *********************************************************:**

    COL             SFAKWMIVGIPTVIVLLGITWLYLRYVAFRHDLKYLPGGQTLIKQKLDELGKMKYEEKVV
    N315            SFAKWMIVGIPTVIVLLGITWLYLRYVAFRHDLKYLPGGQTLIKQKLDELGKMKYEEKVV
    NCTC8325        SFAKWMIVGIPTVIVLLGITWLYLRYVAFRHDLKYLPGGQTLIKQKLDELGKMKYEEKVV
    Newman          SFAKWMIVGIPTVIVLLGITWLYLRYVAFRHDLKYLPGGQTLIKQKLDELGKMKYEEKVV
    USA300_FPR3757  SFAKWMIVGIPTVIVLLGITWLYLRYVAFRHDLKYLPGGQTLIKQKLDELGKMKYEEKVV
                    ************************************************************

    COL             QTIFVLASLLWITREFLLKKWEVTSSVADGTIAIFISILLFIIPAKNTEKHRRIIDWEVA
    N315            QTIFVLASLLWITREFLLKKWEVTSSVADGTIAIFISILLFIIPAKNTEKHRRIIDWEVA
    NCTC8325        QTIFVLASLLWITREFLLKKWEVTSSVADGTIAIFISILLFIIPAKNTEKHRRIIDWEVA
    Newman          QTIFVLASLLWITREFLLKKWEVTSSVADGTIAIFISILLFIIPAKNTEKHRRIIDWEVA
    USA300_FPR3757  QTIFVLASLLWITREFLLKKWEVTSSVADGTIAIFISILLFIIPAKNTEKHRRIIDWEVA
                    ************************************************************

    COL             KELPWGVLILFGGGLALAKGISESGLAKWLGEQLKSLNGVSPILIVIVITIFVLFLTEVT
    N315            KELPWGVLILFGGGLALAKGISESGLAKWLGEQLKSLNGVSPILIVIVITIFVLFLTEVT
    NCTC8325        KELPWGVLILFGGGLALAKGISESGLAKWLGEQLKSLNGVSPILIVIVITIFVLFLTEVT
    Newman          KELPWGVLILFGGGLALAKGISESGLAKWLGEQLKSLNGVSPILIVIVITIFVLFLTEVT
    USA300_FPR3757  KELPWGVLILFGGGLALAKGISESGLAKWLGEQLKSLNGVSPILIVIVITIFVLFLTEVT
                    ************************************************************

    COL             SNTATATMILPILATLSVAVGVHPLLLMAPAAMAANCAYMLPVGTPPNAIIFGSGKISIK
    N315            SNTATATMILPILATLSVAVGVHPLLLMAPAAMAANCAYMLPVGTPPNAIIFGSGKISIK
    NCTC8325        SNTATATMILPILATLSVAVGVHPLLLMAPAAMAANCAYMLPVGTPPNAIIFGSGKISIK
    Newman          SNTATATMILPILATLSVAVGVHPLLLMAPAAMAANCAYMLPVGTPPNAIIFGSGKISIK
    USA300_FPR3757  SNTATATMILPILATLSVAVGVHPLLLMAPAAMAANCAYMLPVGTPPNAIIFGSGKISIK
                    ************************************************************

    COL             QMASVGFWVNLISAIIIILVVYYVMPIVLGIDINQPLPLK
    N315            QMASVGFWVNLISAIIIILVVYYVMPIVLGIDINQPLPLK
    NCTC8325        QMASVGFWVNLISAIIIILVVYYVMPIVLGIDINQPLPLK
    Newman          QMASVGFWVNLISAIIIILVVYYVMPIVLGIDINQPLPLK
    USA300_FPR3757  QMASVGFWVNLISAIIIILVVYYVMPIVLGIDINQPLPLK
                    ****************************************