From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004953000
  • symbol?: pncA
  • description?: pyrazinamidase/nicotinamidase-like protein

      descriptions from strain specific annotations:

    • pyrazinamidase/nicotinamidase-like protein
    • isochorismatase family protein
    • isochorismatase hydrolase
    • Nicotinamidase
    • bifunctional pyrazinamidase/nicotinamidase
    • isochorismatase transposase
    • Pyrazinamidase
  • strand?: +
  • coordinates?: 5141729..5142289
  • synteny block?: BlockID0038570
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1875
    08BA02176:
    C248_1995
    11819-97:
    MS7_1953
    71193:
    ST398NM01_2013
    ECT-R 2:
    ECTR2_1790
    ED133:
    SAOV_2021
    ED98:
    SAAV_1985
    HO 5096 0412:
    SAEMRSA15_18280
    JH1:
    SaurJH1_2008
    JH9:
    SaurJH9_1974
    JKD6008:
    SAA6008_01939
    JKD6159:
    SAA6159_01850
    LGA251:
    SARLGA251_18030
    M013:
    M013TW_1955
    MRSA252:
    SAR2011
    MSHR1132:
    SAMSHR1132_17630
    MSSA476:
    SAS1842
    Mu3:
    SAHV_1903
    Mu50:
    SAV1918
    MW2:
    MW1859
    RF122:
    SAB1855
    ST398:
    SAPIG2013
    T0131:
    SAT0131_02047
    TCH60:
    HMPREF0772_11223 (entB3)
    TW20:
    SATW20_19130
    USA300_TCH1516:
    USA300HOU_1920
    VC40:
    SAVC_08855

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTHRALLVVDYSYDFIADDGLLTCGKPGQNIEDFIVSRINDFNYYQDHIFFLMDLHYLHD
    N315            MTHRALLVVDYSYDFIADDGLLTCGKPGQNIEDFIVSRINDFNYYQDHIFFLMDLHYLHD
    NCTC8325        MTHRALLVVDYSYDFIADDGLLTCGKPGQNIEDFIVSRINDFNYYQDHIFFLMDLHYLHD
    Newman          MTHRALLVVDYSYDFIADDGLLTCGKPGQNIEDFIVSRINDFNYYQDHIFFLMDLHYLHD
    USA300_FPR3757  MTHRALLVVDYSYDFIADDGLLTCGKPGQNIEDFIVSRINDFNYYQDHIFFLMDLHYLHD
                    ************************************************************

    COL             IHHPESKLFPPHNIVDTSGRELYGKVGKLYETIKAQPNVHFIDKTRYDSFFGTPLDSLLR
    N315            IHHPESKLFPPHNIVDTSGRELYGKVGKLYETIKAQPNVHFIDKTRYDSFFGTPLDSLLR
    NCTC8325        IHHPESKLFPPHNIVDTSGRELYGKVGKLYETIKAQPNVHFIDKTRYDSFFGTPLDSLLR
    Newman          IHHPESKLFPPHNIVDTSGRELYGKVGKLYETIKAQPNVHFIDKTRYDSFFGTPLDSLLR
    USA300_FPR3757  IHHPESKLFPPHNIVDTSGRELYGKVGKLYETIKAQPNVHFIDKTRYDSFFGTPLDSLLR
                    ************************************************************

    COL             ERSINQVEIVGVCTDICVLHTAISAYNLGYKISVPAEGVASFNQKGHEWALAHFKNSLGA
    N315            ERSINQVEIVGVCTDICVLHTAISAYNLGYKISVPAEGVASFNQKGHEWALAHFKNSLGA
    NCTC8325        ERSINQVEIVGVCTDICVLHTAISAYNLGYKISVPAEGVASFNQKGHEWALAHFKNSLGA
    Newman          ERSINQVEIVGVCTDICVLHTAISAYNLGYKISVPAEGVASFNQKGHEWALAHFKNSLGA
    USA300_FPR3757  ERSINQVEIVGVCTDICVLHTAISAYNLGYKISVPAEGVASFNQKGHEWALAHFKNSLGA
                    ************************************************************

    COL             EVEQHV
    N315            EVEQHV
    NCTC8325        EVEQHV
    Newman          EVEQHV
    USA300_FPR3757  EVEQHV
                    ******