From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004958000
  • symbol?:
  • description?: 3-carboxy-cis,cis-muconate lactonizing enzyme

      descriptions from strain specific annotations:

    • 3-carboxy-cis,cis-muconate lactonizing enzyme
    • 6-phosphogluconolactonase
    • lactonase, 7-bladed beta-propeller family protein
    • YkgB
  • strand?: -
  • coordinates?: 5145628..5146656
  • synteny block?: BlockID0038620
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1879
    08BA02176:
    C248_2000
    11819-97:
    MS7_1957
    71193:
    ST398NM01_2016
    ECT-R 2:
    ECTR2_1794
    ED133:
    SAOV_2024
    ED98:
    SAAV_1989
    HO 5096 0412:
    SAEMRSA15_18310
    JH1:
    SaurJH1_2011
    JH9:
    SaurJH9_1978
    JKD6008:
    SAA6008_01943
    JKD6159:
    SAA6159_01853
    LGA251:
    SARLGA251_18060
    M013:
    M013TW_1959
    MRSA252:
    SAR2014
    MSHR1132:
    SAMSHR1132_17660
    MSSA476:
    SAS1845
    Mu3:
    SAHV_1906
    Mu50:
    SAV1921
    MW2:
    MW1862
    RF122:
    SAB1858c
    ST398:
    SAPIG2016
    T0131:
    SAT0131_02052
    TCH60:
    HMPREF0772_11219 (ykgB)
    TW20:
    SATW20_19160
    USA300_TCH1516:
    USA300HOU_1925
    VC40:
    SAVC_08870

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTNGYIGSYTKKNGKGIYRFELNENQSRIDLLETGFELEASTYLVRNNEVLYGINKEGEQ
    N315            MTNGYIGSYTKKNGKGIYRFELNENQSRIDLLEIGFELEASTYLVRNNEVLYGINKEGEQ
    NCTC8325        MTNGYIGSYTKKNGKGIYRFELNENQSRIDLLETGFELEASTYLVRNNEVLYGINKEGEQ
    Newman          MTNGYIGSYTKKNGKGIYRFELNENQSRIDLLETGFELEASTYLVRNNEVLYGINKEGEQ
    USA300_FPR3757  MTNGYIGSYTKKNGKGIYRFELNENQSRIDLLETGFELEASTYLVRNNEVLYGINKEGEQ
                    ********************************* **************************

    COL             CGVASLKIDDNGELHLLNKCLSSKAGTGCYVSISEDKRYLFEAVYGAGIIRMYELNTHTG
    N315            CGVASLKIDDNGELHLLNKCLSSKAGTGCYVSISEDKRYLFEAVYGAGIIRMYELNTHTG
    NCTC8325        CGVASLKIDDNGELHLLNKCLSSKAGTGCYVSISEDKRYLFEAVYGAGIIRMYELNTHTG
    Newman          CGVASLKIDDNGELHLLNKCLSSKAGTGCYVSISEDKRYLFEAVYGAGIIRMYELNTHTG
    USA300_FPR3757  CGVASLKIDDNGELHLLNKCLSSKAGTGCYVSISEDKRYLFEAVYGAGIIRMYELNTHTG
                    ************************************************************

    COL             EIIRLIQELAHDFPTGTHERQDHPHAHYINQTPDGKYVAVTDLGADRIVTYKFDDNGFEF
    N315            EIIRLIQELAHDFPTGTHERQDHPHAHYINQTPDGKYVAVTDLGADRIVTYKFDDNGFEF
    NCTC8325        EIIRLIQELAHDFPTGTHERQDHPHAHYINQTPDGKYVAVTDLGADRIVTYKFDDNGFEF
    Newman          EIIRLIQELAHDFPTGTHERQDHPHAHYINQTPDGKYVAVTDLGADRIVTYKFDDNGFEF
    USA300_FPR3757  EIIRLIQELAHDFPTGTHERQDHPHAHYINQTPDGKYVAVTDLGADRIVTYKFDDNGFEF
                    ************************************************************

    COL             YKESLFKDSDGTRHIEFHDNGKFAYVVHELSNTVSVAEYNDGKFEELERHLTIPENFDGD
    N315            YKESLFKDSDGTRHIEFHDNGKFAYVVHELSNTVSVAEYNDGKFEELERHLTIPENFDGD
    NCTC8325        YKESLFKDSDGTRHIEFHDNGKFAYVVHELSNTVSVAEYNDGKFEELERHLTIPENFDGD
    Newman          YKESLFKDSDGTRHIEFHDNGKFAYVVHELSNTVSVAEYNDGKFEELERHLTIPENFDGD
    USA300_FPR3757  YKESLFKDSDGTRHIEFHDNGKFAYVVHELSNTVSVAEYNDGKFEELERHLTIPENFDGD
                    ************************************************************

    COL             TKLAAVRLSHDQQFLYVSNRGHDSIAIFKVLDNGQHLELVTITESGGQFPRDFNIASSDD
    N315            TKLAAVRLSHDQQFLYVSNRGHDSIAIFKVLDNGQHLELVTITESGGQFPRDFNIASSDD
    NCTC8325        TKLAAVRLSHDQQFLYVSNRGHDSIAIFKVLDNGQHLELVTITESGGQFPRDFNIASSDD
    Newman          TKLAAVRLSHDQQFLYVSNRGHDSIAIFKVLDNGQHLELVTITESGGQFPRDFNIASSDD
    USA300_FPR3757  TKLAAVRLSHDQQFLYVSNRGHDSIAIFKVLDNGQHLELVTITESGGQFPRDFNIASSDD
                    ************************************************************

    COL             LLVCAHEQGDSVVTVFERNKETGKITLCDNTRVASEGVCVIF
    N315            LLVCAHEQGDSVVTVFERSKETGKITLCDNTRVASEGVCVIF
    NCTC8325        LLVCAHEQGDSVVTVFERNKETGKITLCDNTRVASEGVCVIF
    Newman          LLVCAHEQGDSVVTVFERNKETGKITLCDNTRVASEGVCVIF
    USA300_FPR3757  LLVCAHEQGDSVVTVFERNKETGKITLCDNTRVASEGVCVIF
                    ******************.***********************