Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN005009000
  • symbol?: eap/map
  • description?: map-ND2C protein

      descriptions from strain specific annotations:

    • map-ND2C protein
    • truncated cell surface protein map-w
    • pseudogene
    • map protein, programmed frameshift
    • MHC class II analog protein
    • cell surface protein MapW2, programmed frameshift
    • MHC class II analog (pseudogene)
    • major histocompatibility complex class II analog protein, Map
    • 65 kDa membrane protein
  • strand?: -
  • coordinates?: 5188349..5190762
  • synteny block?: BlockID0038900
  • occurrence?: in 47% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2002 (map)
    N315:
    NCTC8325:
    Newman:
    NWMN_1872 (map)
    USA300_FPR3757:
    04-02981:
    08BA02176:
    11819-97:
    MS7_1973
    71193:
    ECT-R 2:
    ECTR2_1810
    ED133:
    ED98:
    HO 5096 0412:
    JH1:
    JH9:
    JKD6008:
    SAA6008_01958 (map)
    JKD6159:
    SAA6159_01869
    LGA251:
    M013:
    MRSA252:
    MSHR1132:
    MSSA476:
    SAS1861
    Mu3:
    Mu50:
    MW2:
    MW1880
    RF122:
    ST398:
    T0131:
    SAT0131_02070
    TCH60:
    TW20:
    SATW20_19310 (mapW)
    USA300_TCH1516:
    USA300HOU_1942 (mapW2)
    VC40:
    SAVC_08955

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKFKSLITTTLALGVLASTGANFNNNEASAAAKPLDKSSSSLHHGYSKVHVPYAITVNGT
    N315            MKFKSLITTTLALGVIASTGANFNTNEASAAAKPLDKSSSTLHHGHSNIQIPYTITVNGT
    NCTC8325        MKFKSLITTTLALGVLASTGANFNNNEASAAAKPLDKSSSSLHHGYSKVHVPYAITVNGT
    Newman          MKFKSLITTTLALGVLASTGANFNNNEASAAAKPLDKSSSSLHHGYSKVHVPYAITVNGT
                    ***************:********.***************:****:*::::**:******

    COL             SQNILSSLTFNKNQNISYKDLEDRVKSVLKSDRGISDIDLRLSKQAKYTVYFKNGTKKVI
    N315            SQNILSSLTFNKNQNISYKDIENKVKSVLYFNRGISDIDLRLSKQAEYTVHFKNGTKRVI
    NCTC8325        SQNILSSLTFNKNQNISYKDLEDRVKSVLKSDRGISDIDLRLSKQAKYTVYFKNGTKKVI
    Newman          SQNILSSLTFNKNQNISYKDLEDRVKSVLKSDRGISDIDLRLSKQAKYTVYFKNGTKKVI
                    ********************:*::*****  :**************:***:******:**

    COL             DLKAGIYTADLINTSEIKAININVDTKKQVEDKKKDKANYQVPYTITVNGTSQNILSNLT
    N315            DLKSGIYTADLINTSDIKAISVNVDTKKQPKDKA--KANVQVPYTITVNGTSQNILSNLT
    NCTC8325        DLKAGIYTADLINTSEIKAININVDTKKQVEDKKKDKANYQVPYTITVNGTSQNILSNLT
    Newman          DLKAGIYTADLINTSEIKAININVDTKKQVEDKKKDKANYQVPYTITVNGTSQNILSNLT
                    ***:***********:****.:******* :**   *** ********************

    COL             FNKNQNISYKDLEDKVKSVLESNRGITDVDLRLSKQAKYTVNFKNGTKKVIDLKSGIYTA
    N315            FNKNQNISYKDLEGKVKSVLESNRGITDVDLRLSKQAKYTVNFKNGTKKVIDLKSGIYTA
    NCTC8325        FNKNQNISYKDLEDKVKSVLESNRGITDVDLRLSKQAKYTVNFKNGTKKVIDLKSGIYTA
    Newman          FNKNQNISYKDLEDKVKSVLESNRGITDVDLRLSKQAKYTVNFKNGTKKVIDLKSGIYTA
                    *************.**********************************************

    COL             NLINSSDIKSININVDTKKHIENKAKRNYQVPYSINLNGTSTNILSNLSFSNKPWTNYKN
    N315            NLINSSDIKSININVDTKKHIENKAKRNYQVPYSINLNGTSTNILSNLSFSNKPWTNYKN
    NCTC8325        NLINSSDIKSININVDTKKHIENKAKRNYQVPYSINLNGTSTNILSNLSFSNKPWTNYKN
    Newman          NLINSSDIKSININVDTKKHIENKAKRNYQVPYSINLNGTSTNILSNLSFSNKPWTNYKN
                    ************************************************************

    COL             LTSQIKSVLKHDRGISEQDLKYAKKAYYTVYFKNGGKRILQLNSKNYTANLVHAKDVKRI
    N315            LTSQIKSVLKHDRGISEQDLKYAKKAYYTVYFKNGGKRILQLNSKNYTANLVHAKDVKRI
    NCTC8325        LTSQIKSVLKHDRGISEQDLKYAKKAYYTVYFKNGGKRILQLNSKNYTANLVHAKDVKRI
    Newman          LTSQIKSVLKHDRGISEQDLKYAKKAYYTVYFKNGGKRILQLNSKNYTANLVHAKDVKRI
                    ************************************************************

    COL             EITVKTGTKAKADRYVPYTIAVNGTSTPILSDLKFTGDPRVGYKDISKKVKSVLKHDRGI
    N315            EITVKTGTKAKADR----------------------------------------------
    NCTC8325        EITVKTGTKAKADRYVPYTIAVNGTSTPILSDLKFTGDPRVGYKDISKKVKSVLKHDRGI
    Newman          EITVKTGTKAKADRYVPYTIAVNGTSTPILSDLKFTGDPRVGYKDISKKVKSVLKHDRGI
                    **************                                              

    COL             GERELKYAKKATYTVHFKNGTKKVININSNISQLNLLYVQDIKKIDIDVKTGTKAKADSY
    N315            -----------------------------------------------------------Y
    NCTC8325        GERELKYAKKATYTVHFKNGTKKVININSNISQLNLLYVQDIKKIDIDVKTGTKAKADSY
    Newman          GERELKYAKKATYTVHFKNGTKKVININSNISQLNLLYVQDIKKIDIDVKTGTKAKADSY
                                                                               *

    COL             VPYTIAVNGTSTPILSKLKISNKQLISYKYLNDKVKSVLKSERGISDLDLKFAKQAKYTV
    N315            VPYTIAVNGTSTPILSKLKISNKQLISYKYLNDKVKSVLKSERGISDLDLKFAKQAKYTV
    NCTC8325        VPYTIAVNGTSTPILSKLKISNKQLISYKYLNDKVKSVLKSERGISDLDLKFAKQAKYTV
    Newman          VPYTIAVNGTSTPILSKLKISNKQLISYKYLNDKVKSVLKSERGISDLDLKFAKQAKYTV
                    ************************************************************

    COL             YFKNGKKQVVNLKSDIFTPNLFSAKDIKKIDIDVKQYTKSKKNNKSNNVKFPVTINKFEN
    N315            YFKNGKKQVVNLKSDIFTPNLFSAKDIKKIDIDVKQYTKSKKK-----------------
    NCTC8325        YFKNGKKQVVNLKSDIFTPNLFSAKDIKKIDIDVKQYTKSKKNK----------------
    Newman          YFKNGKKQVVNLKSDIFTPNLFSAKDIKKIDIDVKQYTKSKKNK----------------
                    ******************************************:                 

    COL             IVSNEFVFYNASKITINDLSIKLKSAMANDQGITKHDIGLAERAVYKVYFKNGSSKYVDL
    N315            ------------------------------------------------------------
    NCTC8325        ------------------------------------------------------------
    Newman          ------------------------------------------------------------
                                                                                

    COL             KTEYKDERVFKATDIKKVDIELKF
    N315            ------------------------
    NCTC8325        ------------------------
    Newman          ------------------------