From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN005055000
  • symbol?:
  • description?: phi77 ORF020-like protein, phage major tail protein

      descriptions from strain specific annotations:

    • phi77 ORF020-like protein, phage major tail protein
    • Phage_hypothetical protein
    • prophage pi2 protein 39
    • phage major tail protein, phi13 family protein
    • Phi13 family phage major tail protein
    • pseudogene
  • strand?: -
  • coordinates?: 5219932..5222395
  • synteny block?: BlockID0039310
  • occurrence?: in 53% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1919
    08BA02176:
    11819-97:
    71193:
    ST398NM01_2923
    ECT-R 2:
    ECTR2_1831
    ED133:
    ED98:
    HO 5096 0412:
    SAEMRSA15_18730
    JH1:
    SaurJH1_2050
    JH9:
    SaurJH9_2014
    JKD6008:
    SAA6008_02013
    JKD6159:
    LGA251:
    M013:
    MRSA252:
    SAR2054
    MSHR1132:
    MSSA476:
    Mu3:
    SAHV_1943
    Mu50:
    SAV1957
    MW2:
    RF122:
    ST398:
    T0131:
    SAT0131_02092
    TCH60:
    HMPREF0772_11182
    TW20:
    SATW20_19500
    USA300_TCH1516:
    USA300HOU_1962
    VC40:

Genome Viewer[edit source | edit]

N315 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            MAVKHASAPKAYINITGLGFAKLTKEGAELKYSDITKTRGLQKIGVETGGELKTAYADGG
    Newman          MAVKHASAPKAYINITGLGFAKLTKEGAELKYSDITKTRGLQKIGVETGGDLKTAYADGG
    USA300_FPR3757  MVVKQASAPKAYFNITGLGFAKLTKEGAKLEYSDITKTRGLQKIGVETGGDLKTAYADGG
                    *.**:*******:***************:*:*******************:*********

    N315            PIESGNTDGEGKISLQMHAFPKEIRKIVFNEDYDEDGVYEEKQGKQNNYVAVWFRQERRD
    Newman          PIESGNTDGEGKISLQMHAFPKEIRKIVFNEEYDEDGVYKETQGKQNNYVAIWFRQERRD
    USA300_FPR3757  PIESGNTDGEGKISLQMHAFPKEIRKIVFNEEYDEYGVYKETQGKQNNYVAIWFRQERRD
                    *******************************:*** ***:*.*********:********

    N315            GTFRTVLLPKVMFTNPKIDGETAEKDWDFSSEEVEGEALFPLVDNKKSVRKYIFDSANMT
    Newman          GTFRTVLLPKVMFTNPKIDGETAEKDWDFSSEEVEGEALFPLVDNKKSVRKYIFDSANMT
    USA300_FPR3757  GTFRTVLLPKVMFTNPKIDGETAEKDWDFSSEEVEGEALFPLIDNKKSVRKYIFDSANMT
                    ******************************************:*****************

    N315            NHDGDGEKGEEAFLKKILGEEYTGNVTEGNEETL
    Newman          NHDGDGEKGEEAFLKKILGEEYTGNVTEGNEETL
    USA300_FPR3757  NHSGNGEKGEEAFLKKILGEEYTGNVTEDNGETL
                    **.*:***********************.* ***