From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN005219000
  • symbol?:
  • description?: mobile element-associated protein
  • strand?: -
  • coordinates?: 5380264..5380605
  • synteny block?: BlockID0040430
  • occurrence?: in 38% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    08BA02176:
    11819-97:
    71193:
    ECT-R 2:
    ED133:
    ED98:
    HO 5096 0412:
    SAEMRSA15_19360
    JH1:
    JH9:
    JKD6008:
    JKD6159:
    LGA251:
    M013:
    MRSA252:
    MSHR1132:
    MSSA476:
    SAS1933
    Mu3:
    SAHV_1999
    Mu50:
    SAV2013
    MW2:
    MW1950
    RF122:
    SAB1895c
    ST398:
    T0131:
    SAT0131_02152
    TCH60:
    TW20:
    SATW20_20110
    USA300_TCH1516:
    USA300HOU_2022
    VC40:
    SAVC_09010

Genome Viewer[edit source | edit]

N315 chromosome
NCTC8325 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            MDKKQIKDFVCDYHKRTISDVLIDDEINTDEFFSIGDENSNEWMADDNIDDHIVKNHLEM
    NCTC8325        -------------------------------------------MTDDNVNDHIIKNHIEM
                                                               *:***::***:***:**

    N315            IVDQVANDKEFYIFDSLIQGRSFKDISNVLECSEQSVRLWYETLLDKIVEVIE
    NCTC8325        IVDRLATDKEFYIFDSLIQGLSYQDISSALDCSEQSVILWYETILDKIVGVIK
                    ***::*.************* *::***..*:****** *****:***** **: