From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005268000
  • symbol?: sdrH
  • description?: sdrH protein

      descriptions from strain specific annotations:

    • sdrH protein
    • serine-aspartate repeat-containing protein SdrH
    • Membrane anchored protein
    • membrane anchored Ser-Asp rich fibrinogen-binding protein
    • sdrH protein, putative
    • Ser-Asp rich fibrinogen/bone sialoprotein-binding protein SdrH
    • Ser-Asp rich fibrinogen/bone sialoprotein bindin protein SdrH
    • Serine-aspartate repeat family protein
    • serine-aspartate repeat family protein, SdrH
  • strand?: -
  • coordinates?: 5438457..5439784
  • synteny block?: BlockID0040690
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_1940 (sdrH)
    USA300_FPR3757:
    04-02981:
    SA2981_1973 (sdrH)
    08BA02176:
    C248_2035 (sdrH)
    11819-97:
    MS7_2044 (sdrH)
    71193:
    ST398NM01_2069
    ECT-R 2:
    ECTR2_1883
    ED133:
    SAOV_2069c
    ED98:
    SAAV_2079
    HO 5096 0412:
    SAEMRSA15_19400
    JH1:
    SaurJH1_2106
    JH9:
    SaurJH9_2069
    JKD6008:
    SAA6008_02070 (sdrH)
    JKD6159:
    SAA6159_01946 (sdrH)
    LGA251:
    SARLGA251_18340
    M013:
    M013TW_1984
    MRSA252:
    SAR2119
    MSHR1132:
    SAMSHR1132_18540
    MSSA476:
    SAS1938
    Mu3:
    SAHV_2017
    Mu50:
    SAV2032
    MW2:
    MW1956
    RF122:
    SAB1916c
    ST398:
    SAPIG2069
    T0131:
    SAT0131_02179
    TCH60:
    HMPREF0772_11166
    TW20:
    SATW20_20150
    USA300_TCH1516:
    USA300HOU_2027 (sdrH)
    VC40:
    SAVC_09040

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ----MSYHWFKKMLLSTSILILSSSSLGLATHTVEAKDNLNGEKPTTNLNHNITSPSVNS
    N315            ----MSYHWFKKMLLSTSILILSSSSLGLATHTVEAKDNLNGEKPTTNLNHNITSPSVNS
    NCTC8325        ----MSYHWFKKMLLSTSILILSSSSLGLATHTVEAKDNLNGEKPTTNLNHNITSPSVNS
    Newman          MSREMSYHWFKKMLLSTSILILSSSSLGLATHTVEAKDNLNGEKPTTNLNHNITSPSVNS
    USA300_FPR3757  ----MSYHWFKKMLLSTSILILSSSSLGLATHTVEAKDNLNGEKPTTNLNHNITSPSVNS
                        ********************************************************

    COL             EMNNNETGTPHESNQTGNEGTGSNSRDANPDSNNVKPDSNNQNPSTDSKPDPNNQNPSPN
    N315            EMNNNETGTPHESNQTGNEGTGSNSRDANPDSNNVKPDSNNQNPSTDSKPDPNNQNPSPN
    NCTC8325        EMNNNETGTPHESNQTGNEGTGSNSRDANPDSNNVKPDSNNQNPSTDSKPDPNNQNSSPN
    Newman          EMNNNETGTPHESNQTGNEGTGSNSRDANPDSNNVKPDSNNQNPSTDSKPDPNNQNPSPN
    USA300_FPR3757  EMNNNETGTPHESNQTGNEGTGSNSRDANPDSNNVKPDSNNQNPSTDSKPDPNNQNPSPN
                    ********************************************************.***

    COL             PKPDPDNPKPKPDPKPDPDKPKPNPDPKPDPDNPKPNPDPKPDPDKPKPNPDPKPDPDKP
    N315            PKPDPDNPK----PKPDPDKPKPNLDPKPDPDNPKPKPDPKPDPDKPKPNPDPKPDPDKP
    NCTC8325        PKPDPDNPKPKPDPKPDPDKPKPNPDPKPDPDNPKPNPDPKPDPDKPKPNPDPKPDPDKP
    Newman          PKPDPDNPKPKPDPKPDPDKPKPNPDPKPDPDNPKPNPDPKPDPDKPKPNPDPKPDPDKP
    USA300_FPR3757  PKPDPDNPKPKPDPKPDPDKPKPNPDPKPDPDNPKPNPDPKPDPN--KPNPDPKPDPDKP
                    *********    *********** ***********:*******:  *************

    COL             KPNPNPKPDPNKPNPNPSPDPDQPGDSNHSGGSKNGGTWNPNASDGSNQGQWQPNGNQGN
    N315            KPNPNPKPDPNKPNPNPSPDPDQPGDSNHSGGSKNGGTWNPNASDGSNQGQWQPNGNQGN
    NCTC8325        KPNPNPKPDPNKPNPNPSPDPDQPGDSNHSGGSKNGGTWNPNASDGSNQGQWQPNGNQGN
    Newman          KPNPNPKPDPNKPNPNPSPDPDQPGDSNHSGGSKNGGTWNPNASDGSNQGQWQPNGNQGN
    USA300_FPR3757  KPNPNPKPDPNKPNPNPSPDPDQPGDSNHSGGSKNGGTWNPNASDGSNQGQWQPNGNQGN
                    ************************************************************

    COL             SQNPTGNDFVSQRFLALANGAYKYNPYILNQINKLGKDYGEVTDEDIYNIIRKQNFSGNA
    N315            SQNPTGNDFVSQRFLALANGAYKYNPYILNQINKLGKDYGEVTDEDIYNIIRKQNFSGNA
    NCTC8325        SQNPTGNDFVSQRFLALANGAYKYNPYILNQINKLGKDYGEVTDEDIYNIIRKQNFSGNA
    Newman          SQNPTGNDFVSQRFLALANGAYKYNPYILNQINKLGKDYGEVTDEDIYNIIRKQNFSGNA
    USA300_FPR3757  SQNPTGNDFVSQRFLALANGAYKYNPYILNQINKLGKDYGEVTDEDIYNIIRKQNFSGNA
                    ************************************************************

    COL             YLNGLQQQSNYFRFQYFNPLKSERYYRNLDEQVLALITGEIGSMPDLKKPEDKPDSKQRS
    N315            YLNGLQQQSNYFRFQYFNPLKSERYYRNLDEQVLALITGEIGSMPDLKKPEDKPDSKQRS
    NCTC8325        YLNGLQQQSNYFRFQYFNPLKSERYYRNLDEQVLALITGEIGSMPDLKKPEDKPDSKQRS
    Newman          YLNGLQQQSNYFRFQYFNPLKSERYYRNLDEQVLALITGEIGSMPDLKKPEDKPDSKQRS
    USA300_FPR3757  YLNGLQQQSNYFRFQYFNPLKSERYYRNLDEQVLALITGEIGSMPDLKKPEDKPDSKQRS
                    ************************************************************

    COL             FEPHEKDDFTVVKKQEDNKKSASTAYSKSWLAIVCSMMVVFSIMLFLFVKRNKKKNKNES
    N315            FEPHEKDDFTVVKKQEDNKKSASTAYSKSWLAIVCSMMVVFSIMLFLFVKRNKKKNKNES
    NCTC8325        FEPHEKDDFTVVKKQEDNKKSASTAYSKSWLAIVCSMMVVFSIMLFLFVKRNKKKNKNES
    Newman          FEPHEKDDFTVVKKQEDNKKSASTAYSKSWLAIVCSMMVVFSIMLFLFVKRNKKKNKNES
    USA300_FPR3757  FEPHEKDDFTVVKKQEDNKKSASTAYSKSWLAIVCSMMVVFSIMLFLFVKRNKKKNKNES
                    ************************************************************

    COL             QRR
    N315            QRR
    NCTC8325        QRR
    Newman          QRR
    USA300_FPR3757  QRR
                    ***