From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005275000
  • symbol?: agrB
  • description?: accessory gene regulator protein B

      descriptions from strain specific annotations:

    • accessory gene regulator protein B
    • accessory gene regulator AgrB
    • accessory gene regulator B
    • accessory gene regulator B family protein
    • accessory gene regulator protein B AGRB
    • agrB protein
    • putative autoinducer processing protein
    • Regulator protein agrB
  • strand?: +
  • coordinates?: 5442847..5443468
  • synteny block?: BlockID0040760
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2023 (agrB)
    N315:
    SA1842 (agrB)
    NCTC8325:
    Newman:
    NWMN_1943 (agrB)
    USA300_FPR3757:
    04-02981:
    SA2981_1977 (agrB)
    08BA02176:
    C248_2040 (agrB)
    11819-97:
    MS7_2048 (agrB)
    71193:
    ST398NM01_2073
    ECT-R 2:
    ECTR2_1887
    ED133:
    SAOV_2073
    ED98:
    SAAV_2084 (agrB)
    HO 5096 0412:
    SAEMRSA15_19440 (agrB)
    JH1:
    SaurJH1_2110
    JH9:
    SaurJH9_2073
    JKD6008:
    SAA6008_02074 (agrB)
    JKD6159:
    SAA6159_01949 (agrB)
    LGA251:
    SARLGA251_18380 (agrB)
    M013:
    M013TW_1988
    MRSA252:
    SAR2123 (agrB)
    MSHR1132:
    SAMSHR1132_18580
    MSSA476:
    SAS1941
    Mu3:
    SAHV_2021 (agrB)
    Mu50:
    SAV2036 (agrB)
    MW2:
    MW1960 (agrB)
    RF122:
    SAB1920 (agrB)
    ST398:
    SAPIG2073
    T0131:
    SAT0131_02183
    TCH60:
    HMPREF0772_11163 (agrB)
    TW20:
    SATW20_20190 (agrB)
    USA300_TCH1516:
    USA300HOU_2032 (agrB)
    VC40:
    SAVC_09060

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNYFDNKIDQFATYLQKRNNLDHIQFLQVRLGMQVLAKNIGKLIVMYTIAYILNIFLFTL
    N315            MNYFDNKIDQFATYLQKRNNLDHIQFLQVRLGMQIIVGNFFKILVTYSISIFLSVFLFTL
    NCTC8325        MNYFDNKIDQFATYLQKRNNLDHIQFLQVRLGMQVLAKNIGKLIVMYTIAYILNIFLFTL
    Newman          MNYFDNKIDQFATYLQKRNNLDHIQFLQVRLGMQVLAKNIGKLIVMYTIAYILNIFLFTL
    USA300_FPR3757  MNYFDNKIDQFATYLQKRNNLDHIQFLQVRLGMQVLAKNIGKLIVMYTIAYILNIFLFTL
                    **********************************::. *: *::* *:*: :*.:*****

    COL             ITNLTFYLIRRHAHGAHAPSSFWCYVESIILFILLPLVIVNFHINFLIMIILTVISLGVI
    N315            VTHLSYMLIRYNAHGAHAKSSILCYIQSILTFVFVPYFLINIDINFTYLLALSIIGLISV
    NCTC8325        ITNLTFYLIRRHAHGAHAPSSFWCYVESIILFILLPLVIVNFHINFLIMIILTVISLGVI
    Newman          ITNLTFYLIRRHAHGAHAPSSFWCYVESIILFILLPLVIVNFHINFLIMIILTVISLGVI
    USA300_FPR3757  ITNLTFYLIRRHAHGAHAPSSFWCYVESIILFILLPLVIVNFHINFLIMIILTVISLGVI
                    :*:*:: *** :****** **: **::**: *:::* .::*:.***  :: *::*.*  :

    COL             SVYAPAATKKKPIPVRLIKRKKYYAIIVSLTLFIITLIIKEPFAQFIQLGIIIEAITLLP
    N315            VIYAPAATKKQPIPIKLVKRKKYLSIIMYLLVLILSLIIHPFYAQFMLLGILVESITLLP
    NCTC8325        SVYAPAATKKKPIPVRLIKRKKYYAIIVSLTLFIITLIIKEPFAQFIQLGIIIEAITLLP
    Newman          SVYAPAATKKKPIPVRLIKRKKYYAIIVSLTLFIITLIIKEPFAQFIQLGIIIEAITLLP
    USA300_FPR3757  SVYAPAATKKKPIPVRLIKRKKYYAIIVSLTLFIITLIIKEPFAQFIQLGIIIEAITLLP
                     :********:***::*:***** :**: * ::*::***:  :***: ***::*:*****

    COL             IFFIKEDLK
    N315            IFFPKED--
    NCTC8325        IFFIKEDLK
    Newman          IFFIKEDLK
    USA300_FPR3757  IFFIKEDLK
                    *** ***