From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005279000
  • symbol?: agrC
  • description?: accessory gene regulator protein C

      descriptions from strain specific annotations:

    • accessory gene regulator protein C
    • ATP-binding protein
    • accessory gene regulator C
    • accessory protein regulator protein C
    • Accessory regulator C
    • autoinducer sensor AgrC
    • autoinducer sensor protein
    • histidine kinase-, DNA gyrase B-, and HSP90-like ATPase family protein
    • Histidine kinase of the competence regulon ComD
    • Regulator protein agrC
    • staphylococcal accessory gene regulator protein C
  • strand?: +
  • coordinates?: 5443647..5446662
  • synteny block?: BlockID0040800
  • occurrence?: in 75% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2025 (argC2)
    N315:
    NCTC8325:
    Newman:
    NWMN_1945 (agrC)
    USA300_FPR3757:
    04-02981:
    08BA02176:
    C248_2042 (agrC)
    11819-97:
    MS7_2049
    71193:
    ST398NM01_2075
    ECT-R 2:
    ED133:
    SAOV_2075
    ED98:
    HO 5096 0412:
    SAEMRSA15_19460 (agrC)
    JH1:
    JH9:
    JKD6008:
    SAA6008_02076
    JKD6159:
    SAA6159_01951
    LGA251:
    SARLGA251_18400 (agrC)
    M013:
    M013TW_1990
    MRSA252:
    SAR2125 (agrC)
    MSHR1132:
    SAMSHR1132_18600
    MSSA476:
    SAS1943
    Mu3:
    Mu50:
    MW2:
    MW1962 (agrC)
    RF122:
    SAB1922 (agrC)
    ST398:
    SAPIG2075
    T0131:
    SAT0131_02188
    TCH60:
    HMPREF0772_11161 (argC2)
    TW20:
    SATW20_20210 (agrC)
    USA300_TCH1516:
    USA300HOU_2034 (agrC)
    VC40:
    SAVC_09070

Genome Viewer[edit source | edit]

COL chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MELLNSYNFVLFVLTQMILMFTIPAIISGIKYSKLDYFFIIVISTLSLFLFKMFDSASLI
    NCTC8325        ----------------MILMFTIPAIISGIKYSKLDYFFIIVISTLSLFLFKMFDSASLI
    Newman          MELLNSYNFVLFVLTQMILMFTIPAIISGIKYSKLDYFFIIVISTLSLFLFKMFDSASLI
    USA300_FPR3757  ----------------MILMFTIPAIISGIKYSKLDYFFIIVISTLSLFLFKMFDSASLI
                                    ********************************************

    COL             ILTSFIIIMYFVKIKWYSILLIMTSQIILYCANYMYIVIYAYITKISDSIFVIFPSFFVV
    NCTC8325        ILTSFIIIMYFVKIKWYSILLIMTSQIILYCANYMYIVIYAYITKISDSIFVIFPSFFVV
    Newman          ILTSFIIIMYFVKIKWYSILLIMTSQIILYCANYMYIVIYAYITKISDSIFVIFPSFFVV
    USA300_FPR3757  ILTSFIIIMYFVKIKWYSILLIMTSQIILYCANYMYIVIYAYITKISDSIFVIFPSFFVV
                    ************************************************************

    COL             YVTISILFSYIINRVLKKISTPYLILNKGFLIVISTILLLTFSLFFFYSQINSDEAKVIR
    NCTC8325        YVTISILFSYIINRVLKKISTPYLILNKGFLIVISTILLLTFSLFFFYSQINSDEAKVIR
    Newman          YVTISILFSYIINRVLKKISTPYLILNKGFLIVISTILLLTFSLFFFYSQINSDEAKVIR
    USA300_FPR3757  YVTISILFSYIINRVLKKISTPYLILNKGFLIVISTILLLTFSLFFFYSQINSDEAKVIR
                    ************************************************************

    COL             QYSFIFIGITIFLSILTFVISQFLLKEMKYKRNQEEIETYYEYTLKIEAINNEMRKFRHD
    NCTC8325        QYSFIFIGITIFLSILTFVISQFLLKEMKYKRNQEEIETYYEYTLKIEAINNEMRKFRHD
    Newman          QYSFIFIGITIFLSILTFVISQFLLKEMKYKRNQEEIETYYEYTLKIEAINNEMRKFRHD
    USA300_FPR3757  QYSFIFIGITIFLSILTFVISQFLLKEMKYKRNQEEIETYYEYTLKIEAINNEMRKFRHD
                    ************************************************************

    COL             YVNILTPLSEYIREDDMPGLRDYFNKNIVPMKDNLQMNAIKLNGIENLKVREIKGLITAK
    NCTC8325        YVNILTTLSEYIREDDMPGLRDYFNKNIVPMKDNLQMNAIKLNGIENLKVREIKGLITAK
    Newman          YVNILTTLSEYIREDDMPGLRDYFNKNIVPMKDNLQMNAIKLNGIENLKVREIKGLITAK
    USA300_FPR3757  YVNILTTLSEYIREDDMPGLRDYFNKNIVPMKDNLQMNAIKLNGIENLKVREIKGLITAK
                    ******.*****************************************************

    COL             ILRAQEMNIPISIEIPDEVSSINLNMIDLSRSIGIILDNAIEASTEIDDPIIRVAFIESE
    NCTC8325        ILRAQEMNIPISIEIPDEVSSINLNMIDLSRSIGIILDNAIEASTEIDDPIIRVAFIESE
    Newman          ILRAQEMNIPISIEIPDEVSSINLNMIDLSRSIGIILDNAIEASTEIDDPIIRVAFIESE
    USA300_FPR3757  ILRAQEMNFPISIEIPDEVSSINLNMIDLSRSIGIILDNAIEASTEIDDPIIRVAFIESE
                    ********:***************************************************

    COL             NSVTFIVMNKCADDIPRIHELFQESFSTKGEGRGLGLSTLKEIADNADNVLLDTIIENGF
    NCTC8325        NSVTFIVMNKCADDIPRIHELFQESFSTKGEGRGLGLSTLKEIADNADNVLLDTIIENGF
    Newman          NSVTFIVMNKCADDIPRIHELFQESFSTKGEGRGLGLSTLKEIADNADNVLLDTIIENGF
    USA300_FPR3757  NSVTFIVMNKCADDIPRIHELFQESFSTKGEGRGLGLSTLKEIADNADNVLLDTIIENGF
                    ************************************************************

    COL             FIQKVEIINN
    NCTC8325        FIQKVEIINN
    Newman          FIQKVEIINN
    USA300_FPR3757  FIQKVEIINN
                    **********