From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005281000
  • symbol?: agrA
  • description?: DNA-binding response regulator

      descriptions from strain specific annotations:

    • DNA-binding response regulator
    • accessory gene regulator protein A
    • accessory gene regulator A
    • staphylococcal accessory gene regulator A
    • Response regulator of the competence regulon ComE
    • AgrA
    • agrA protein
    • autoinducer sensor protein response regulator protein
    • LytTR family two component transcriptional regulator
    • response regulator receiver
  • strand?: +
  • coordinates?: 5446681..5447397
  • synteny block?: BlockID0040810
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2026 (agrA)
    N315:
    SA1844 (agrA)
    NCTC8325:
    Newman:
    NWMN_1946 (agrA)
    USA300_FPR3757:
    04-02981:
    SA2981_1980 (agrA)
    08BA02176:
    C248_2043 (agrA)
    11819-97:
    MS7_2050 (agrA)
    71193:
    ST398NM01_2076
    ECT-R 2:
    ECTR2_1890
    ED133:
    SAOV_2076
    ED98:
    SAAV_2087 (agrA)
    HO 5096 0412:
    SAEMRSA15_19470 (agrA)
    JH1:
    SaurJH1_2112
    JH9:
    SaurJH9_2076
    JKD6008:
    SAA6008_02077 (agrA)
    JKD6159:
    SAA6159_01952 (agrA)
    LGA251:
    SARLGA251_18410 (agrA)
    M013:
    M013TW_1991
    MRSA252:
    SAR2126 (agrA)
    MSHR1132:
    SAMSHR1132_18610
    MSSA476:
    SAS1944
    Mu3:
    SAHV_2024 (agrA)
    Mu50:
    SAV2039 (agrA)
    MW2:
    MW1963 (agrA)
    RF122:
    SAB1923 (agrA)
    ST398:
    SAPIG2076
    T0131:
    SAT0131_02189
    TCH60:
    HMPREF0772_11160 (agrA)
    TW20:
    SATW20_20220 (agrA)
    USA300_TCH1516:
    USA300HOU_2035 (agrA)
    VC40:
    SAVC_09075

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKIFICEDDPKQRENMVTIIKNYIMIEEKPMEIALATDNPYEVLEQAKNMNDIGCYFLDI
    N315            MKIFICEDDPKQRENMVTIIKNYIMIEEKPMEIALATDNPYEVLEQAKNMNDIGCYFLDI
    NCTC8325        ------------------------------MEIALATDNPYEVLEQAKNMNDIGCYFLDI
    Newman          MKIFICEDDPKQRENMVTIIKNYIMIEEKPMEIALATDNPYEVLEQAKNMNDIGCYFLDI
    USA300_FPR3757  ------------------------------MEIALATDNPYEVLEQAKNMNDIGCYFLDI
                                                  ******************************

    COL             QLSTDINGIKLGSEIRKHDPVGNIIFVTSHSELTYLTFVYKVAAMDFIFKDDPAELRTRI
    N315            QLSTDINGIKLGSEIRKHDPVGNIIFVTSHSELTYLTFVYKVAAMDFIFKDDPAELRTRI
    NCTC8325        QLSTDINGIKLGSEIRKHDPVGNIIFVTSHSELTYLTFVYKVAAMDFIFKDDPAELRTRI
    Newman          QLSTDINGIKLGSEIRKHDPVGNIIFVTSHSELTYLTFVYKVAAMDFIFKDDPAELRTRI
    USA300_FPR3757  QLSTDINGIKLGSEIRKHDPVGNIIFVTSHSELTYLTFVYKVAAMDFIFKDDPAELRTRI
                    ************************************************************

    COL             IDCLETAHTRLQLLSKDNSVETIELKRGSNSVYVQYDDIMFFESSTKSHRLIAHLDNRQI
    N315            IDCLETAHTRLQLLSKDNSVETIELKRGSNSVYVQYDDIMFFESSTKSHRLIAHLDNRQI
    NCTC8325        IDCLETAHTRLQLLSKDNSVETIELKRGSNSVYVQYDDIMFFESSTKSHRLIAHLDNRQI
    Newman          IDCLETAHTRLQLLSKDNSVETIELKRGSNSVYVQYDDIMFFESSTKSHRLIAHLDNRQI
    USA300_FPR3757  IDCLETAHTRLQLLSKDNSVETIELKRGSNSVYVQYDDIMFFESSTKSHRLIAHLDNRQI
                    ************************************************************

    COL             EFYGNLKELSQLDDRFFRCHNSFVVNRHNIESIDSKERIVYFKNKEHCYASVRNVKKI
    N315            EFYGNLKELSQLDDRFFRCHNSFVVNRHNIESIDSKERIVYFKNKEHCYASVRNVKKI
    NCTC8325        EFYGNLKELSQLDDRFFRCHNSFVVNRHNIESIDSKERIVYFKNKEHCYASVRNVKKI
    Newman          EFYGNLKELSQLDDRFFRCHNSFVVNRHNIESIDSKERIVYFKNKEHCYASVRNVKKI
    USA300_FPR3757  EFYGNLKELSQLDDRFFRCHNSFVVNRHNIESIDSKERIVYFKNKEHCYASVRNVKKI
                    **********************************************************