From AureoWiki
Jump to: navigation, search

NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_1992 [new locus tag: SAUSA300_RS10950 ]
  • pan locus tag?: SAUPAN005281000
  • symbol: agrA
  • pan gene symbol?: agrA
  • synonym:
  • product: accessory gene regulator protein A

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAUSA300_1992 [new locus tag: SAUSA300_RS10950 ]
  • symbol: agrA
  • product: accessory gene regulator protein A
  • replicon: chromosome
  • strand: +
  • coordinates: 2149074..2149700
  • length: 627
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGGAAATTGCCCTCGCAACTGATAATCCTTATGAGGTGCTTGAGCAAGCTAAAAATATG
    AATGACATAGGCTGTTACTTTTTAGATATTCAACTTTCAACTGATATTAATGGTATCAAA
    TTAGGCAGTGAAATTCGTAAGCATGACCCAGTTGGTAACATTATTTTCGTTACGAGTCAC
    AGTGAACTTACCTATTTAACATTTGTCTACAAAGTTGCAGCGATGGATTTTATTTTTAAA
    GATGATCCAGCTGAATTAAGAACTCGAATTATAGACTGTTTAGAAACTGCACATACACGC
    TTACAATTGTTGTCTAAAGATAATAGCGTTGAAACGATTGAATTAAAACGTGGCAGTAAT
    TCAGTGTATGTTCAATATGATGATATTATGTTTTTTGAATCATCAACAAAATCTCACAGA
    CTCATTGCCCATTTAGATAACCGTCAAATTGAATTTTATGGTAATTTAAAAGAACTGAGT
    CAATTAGATGATCGTTTCTTTAGATGTCATAATAGCTTTGTCGTCAATCGCCATAATATT
    GAATCTATAGATTCGAAAGAGCGAATTGTCTATTTTAAAAATAAAGAACACTGCTATGCA
    TCGGTGAGAAACGTTAAAAAAATATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    627

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAUSA300_1992 [new locus tag: SAUSA300_RS10950 ]
  • symbol: AgrA
  • description: accessory gene regulator protein A
  • length: 208
  • theoretical pI: 6.30674
  • theoretical MW: 24253.4
  • GRAVY: -0.362981

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismCentral intermediary metabolismNitrogen metabolismnitrogen regulation protein NR(I) (TIGR01818; HMM-score: 10.9)
    Signal transductionRegulatory functionsDNA interactionsnitrogen regulation protein NR(I) (TIGR01818; HMM-score: 10.9)
    Signal transductionSignal transductionTwo-component systemsnitrogen regulation protein NR(I) (TIGR01818; HMM-score: 10.9)
  • TheSEED:  
    Response regulator of the competence regulon ComE 
  • PFAM:
    Tudor (CL0049) LytTR; LytTr DNA-binding domain (PF04397; HMM-score: 72.8)
    CheY (CL0304) Response_reg; Response regulator receiver domain (PF00072; HMM-score: 68.1)
    TPR (CL0020) Suf; Suppressor of forked protein (Suf) (PF05843; HMM-score: 12.9)

Structure, modifications & interactions[edit source | edit]

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.104
    • Ymax_pos: 47
    • Cmax: 0.119
    • Cmax_pos: 7
    • Smax: 0.136
    • Smax_pos: 43
    • Smean: 0.079
    • D: 0.095
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MEIALATDNPYEVLEQAKNMNDIGCYFLDIQLSTDINGIKLGSEIRKHDPVGNIIFVTSHSELTYLTFVYKVAAMDFIFKDDPAELRTRIIDCLETAHTRLQLLSKDNSVETIELKRGSNSVYVQYDDIMFFESSTKSHRLIAHLDNRQIEFYGNLKELSQLDDRFFRCHNSFVVNRHNIESIDSKERIVYFKNKEHCYASVRNVKKI

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: CodY
    CodY (TF) important in Amino acid metabolism  RegPrecise    transcription unit transferred from N315 data RegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]