From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005284000
  • symbol?: scrB
  • description?: sucrose-6-phosphate hydrolase

      descriptions from strain specific annotations:

    • sucrose-6-phosphate hydrolase
    • sucrose-6-phosphate hydrolase (Sucrase) (Invertase)
    • sucrose-6-phosphate hydrolase family protein
  • strand?: -
  • coordinates?: 5448738..5450222
  • synteny block?: BlockID0040840
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2029 (cscA)
    N315:
    SA1846 (scrB)
    NCTC8325:
    Newman:
    NWMN_1948 (scrB)
    USA300_FPR3757:
    04-02981:
    SA2981_1982 (scrB)
    08BA02176:
    C248_2045 (scrB)
    11819-97:
    MS7_2052
    71193:
    ST398NM01_2078
    ECT-R 2:
    ECTR2_1892
    ED133:
    SAOV_2078c
    ED98:
    SAAV_2089 (cscA)
    HO 5096 0412:
    SAEMRSA15_19490 (scrB)
    JH1:
    SaurJH1_2114
    JH9:
    SaurJH9_2078
    JKD6008:
    SAA6008_02079 (scrB)
    JKD6159:
    SAA6159_01954 (scrB)
    LGA251:
    SARLGA251_18430 (scrB)
    M013:
    M013TW_1993
    MRSA252:
    SAR2128 (scrB)
    MSHR1132:
    SAMSHR1132_18630
    MSSA476:
    SAS1946
    Mu3:
    SAHV_2026 (scrB)
    Mu50:
    SAV2041 (scrB)
    MW2:
    MW1965 (scrB)
    RF122:
    SAB1925c (scrB)
    ST398:
    SAPIG2078
    T0131:
    SAT0131_02191
    TCH60:
    HMPREF0772_11158 (scrB)
    TW20:
    SATW20_20240 (scrB)
    USA300_TCH1516:
    USA300HOU_2038 (scrB)
    VC40:
    SAVC_09085

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTEWTGEERYQRIEDVDTEYFKTLKQQVDQSKFRQQFHIQPETGLLNDPNGLIFYKGKYY
    N315            MTEWTREERYQRIEDVDTEYFKTLKQQVDQSKFRQQFHIQPETGLLNDPNGLIFYKGKYY
    NCTC8325        MTEWTREERYQRIEDVDTEYFKTLKQQVDQSKFRQQFHIQPETGLLNDPNGLIFYKGKYY
    Newman          MTEWTREERYQRIEDVDTEYFKTLKQQVDQSKFRQQFHIQPETGLLNDPNGLIFYKGKYY
    USA300_FPR3757  MTEWTREERYQRIEDVDTEYFKTLKQQVDQSKFRQQFHIQPETGLLNDPNGLIFYKGKYY
                    ***** ******************************************************

    COL             VSHQWFPLGAVHGLKYWYNYTSDDLINFKAEGPILNPDTKYDSHGVYSGSAFEYNGHLYY
    N315            VSHQWFPLGAVHGLKYWYNYTSDDLINFKPEGPILNPDTKYDSHGVYSGSAFEYNGHLYY
    NCTC8325        VSHQWFPLGAVHGLKYWYNYTSDDLINFKAEGPILNPDTKYDSHGVYSGSAFEYNGHLYY
    Newman          VSHQWFPLGAVHGLKYWYNYTSDDLINFKAEGPILNPDTKYDSHGVYSGSAFEYNGHLYY
    USA300_FPR3757  VSHQWFPLGAVHGLKYWYNYTSDDLINFKAEGPILNPDTKYDSHGVYSGSAFEYNGHLYY
                    *****************************.******************************

    COL             MYTGNHRDNHWQRHASQMIARLKEDGSVEKFPKPVISQQPEGYTSHFRDPKVFKYDEKYY
    N315            MYTGNHRDNHWQRHASQMIARLKEDGSVEKFPKPVISQQPEGYTSHFRDPKVFKYGEKYY
    NCTC8325        MYTGNHRDNHWQRHASQMIARLKEDGSVEKFPKPVISQQPEGYTSHFRDPKVFKYDEKYY
    Newman          MYTGNHRDNHWQRHASQMIARLKEDGSVEKFPKPVISQQPEGYTSHFRDPKVFKYDEKYY
    USA300_FPR3757  MYTGNHRDNHWQRHASQMIARLKEDGSVEKFPKPVISQQPEGYTSHFRDPKVFKYDEKYY
                    *******************************************************.****

    COL             AIIGAQNNDQQGRLLLYNTEDIINWHYLGEINTELDDFGYMWECPDYFNVDNQDVILICP
    N315            AIIGAQNNDQQGRLLLYNTEDIINWHYLGEINTELDDFGYMWECPDYFNLDNQDVILICP
    NCTC8325        AIIGAQNNDQQGRLLLYNTEDIINWHYLGEINTELDDFGYMWECPDYFNVDNQDVILICP
    Newman          AIIGAQNNDQQGRLLLYNTEDIINWHYLGEINTELDDFGYMWECPDYFNVDNQDVILICP
    USA300_FPR3757  AIIGAQNNDQQGRLLLYNTEDIINWHYLGEINTELDDFGYMWECPDYFNVDNQDVILICP
                    *************************************************:**********

    COL             QGIEPKGDQFKNIYQSGYILGKFDIEKLTYEHENFVELDNGFDFYAPQTFLDEKGRRVLI
    N315            QGIEPKGNQFKNIYQSGYILGKFDIEKLTYEHENFVELDNGFDFYAPQTFLDEKGRRVLI
    NCTC8325        QGIEPKGDQFKNIYQSGYILGKFDIEKLTYEHENFVELDNGFDFYAPQTFLDEKGRRVLI
    Newman          QGIEPKGDQFKNIYQSGYILGKFDIEKLTYEHENFVELDNGFDFYAPQTFLDEKGRRVLI
    USA300_FPR3757  QGIEPKGDQFKNIYQSGYILGKFDIEKLTYEHENFVELDNGFDFYAPQTFLDEKGRRVLI
                    *******:****************************************************

    COL             GWMGLPEIEYPTDNEGWAHCLTTPRVLNVENGQLKQRPYPALEKLRHNKETALGYANKFT
    N315            GWMGLPEIEYPTDNEGWAHCLTIPRVLNVENGQLKQRPYPALEKLRHNKETALGYANKFT
    NCTC8325        GWMGLPEIEYPTDNEGWAHCLTIPRVLNVENGQLKQRPYPALEKLRHNKETALGYANKFT
    Newman          GWMGLPEIEYPTDNEGWAHCLTIPRVLNVENGQLKQRPYPALEKLRHNKETALGYANKFT
    USA300_FPR3757  GWMGLPEIEYPTDNEGWAHCLTIPRVLNVENGQLKQRPYPALEKLRHNKETALGYANKFT
                    ********************** *************************************

    COL             RKLHPYEGKQYELIIDILDNDATEVYFELRTSKTSSTLIAYNKRENKITLDRSDSGLLPT
    N315            RKLHPYEGKQYELIIDILDNDATEVYFELRTSKTSSTLIAYNKRENKITLDRSDSGLLPT
    NCTC8325        RKLHPYEGKQYELIIDILDNDATEVYFELRTSKTSSTLIAYNKRENKITLDRSDSGLLPT
    Newman          RKLHPYEGKQYELIIDILDNDATEVYFELRTSKTSSTLIAYNKRENKITLDRSDSGLLPT
    USA300_FPR3757  RKLHPYEGKQYELIIDILDNDATEVYFELRTSKTSSTLIAYNKRENKITLDRSDSGLLPT
                    ************************************************************

    COL             NVEGTTRSTILDTPLKQLQIFVDTSSIEIFCNDGERVLTSRIFPTEDALGIKTSTESGQV
    N315            NVEGTTRSTILDTPLKQLQIFVDTSSIEIFCNDGERVLTSRIFPTEDALGIKTSTESGQV
    NCTC8325        NVEGTTRSTILDTPLKQLQIFVDTSSIEIFCNDGERVLTSRIFPTEDALGIKTSTESGQV
    Newman          NVEGTTRSTILDTPLKQLQIFVDTSSIEIFCNDGERVLTSRIFPTEDALGIKTSTESGQV
    USA300_FPR3757  NVEGTTRSTILDTPLKQLQIFVDTSSIEIFCNDGERVLTSRIFPTEDALGIKTSTESGQV
                    ************************************************************

    COL             YLQFTKYDLKDEHK
    N315            YLQFTKYDLKDEHK
    NCTC8325        YLQFTKYDLKDEHK
    Newman          YLQFTKYDLKDEHK
    USA300_FPR3757  YLQFTKYDLKDEHK
                    **************