From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005292000
  • symbol?: vga
  • description?: ABC transporter ATP-binding protein

      descriptions from strain specific annotations:

    • ABC transporter ATP-binding protein
    • ABC superfamily ATP binding cassette transporter, ABC protein
    • ABC transporter ATP-binding protein uup
    • ABC transporter family protein
    • ATP-binding ABC transporter protein
    • heme ABC transporter ATP-binding protein CcmA
    • putative ABC transporter ATP-binding protein
  • strand?: +
  • coordinates?: 5455544..5457520
  • synteny block?: BlockID0040920
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA1852 (vga)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1988 (vga)
    08BA02176:
    C248_2051
    11819-97:
    MS7_2058
    71193:
    ST398NM01_2085
    ECT-R 2:
    ECTR2_1898
    ED133:
    SAOV_2084
    ED98:
    SAAV_2095
    HO 5096 0412:
    SAEMRSA15_19550
    JH1:
    SaurJH1_2121
    JH9:
    SaurJH9_2084
    JKD6008:
    SAA6008_02085
    JKD6159:
    SAA6159_01960
    LGA251:
    SARLGA251_18490
    M013:
    M013TW_1999
    MRSA252:
    SAR2134
    MSHR1132:
    SAMSHR1132_18690
    MSSA476:
    SAS1952
    Mu3:
    SAHV_2032 (vga)
    Mu50:
    SAV2047 (vga)
    MW2:
    MW1971 (vga)
    RF122:
    SAB1931
    ST398:
    SAPIG2085
    T0131:
    SAT0131_02198 (ssaA)
    TCH60:
    HMPREF0772_11152
    TW20:
    SATW20_21870
    USA300_TCH1516:
    VC40:
    SAVC_09115

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MILLQLNHISKSFDGEDIFTDVDFEVKTGERIGIVGRNGAGKSTLMKIIAGVENYDSGNV
    N315            MILLQLNHISKSFDGEDIFTDVDFEVKTGERIGIVGRNGAGKSTLMKIIAGVENYDSGNV
    NCTC8325        MILLQLNHISKSFDGEDIFTDVDFEVKTGERIGIVGRNGAGKSTLMKIIAGVENYDSGNV
    Newman          MILLQLNHISKSFDGEDIFTDVDFEVKTGERIGIVGRNGAGKSTLMKIIAGVENYDSGNV
    USA300_FPR3757  MILLQLNHISKSFDGEDIFTDVDFEVKTGERIGIVGRNGAGKSTLMKIIAGVENYDSGNV
                    ************************************************************

    COL             SKIKNLKLGYLTQQMTLNSNATVFEEMSKPFEHIKRMESLIKEETDWLSKHANDYDSDTY
    N315            SKIKNLKLGYLTQQMTLNSNATVFEEMSKPFEHIKRMESLIKEETDWLSKHANDYDSDTY
    NCTC8325        SKIKNLKLGYLTQQMTLNSNATVFEEMSKPFEHIKRMESLIKEETDWLSKHANDYDSDTY
    Newman          SKIKNLKLGYLTQQMTLNSNATVFEEMSKPFEHIKRMESLIKEETDWLSKHANDYDSDTY
    USA300_FPR3757  SKIKNLKLGYLTQQMTLNSNATVFEEMSKPFEHIKRMESLIKEETDCLSKHANDYDSDTY
                    ********************************************** *************

    COL             KTHMSRYESLSNQFEQLEGYQYESKIKTVLYGLNFSEEDFNKPINDFSGGQKTRLSLAQM
    N315            KTHMSRYESLSNQFEQLEGYQYESKIKTVLHGLNFSEEDFNKPINDFSGGQKTRLSLAQM
    NCTC8325        KTHMSRYESLSNQFEQLEGYQYESKIKTVLYGLNFSEEDFNKPINDFSGGQKTRLSLAQM
    Newman          KTHMSRYESLSNQFEQLEGYQYESKIKTVLYGLNFSEEDFNKPINDFSGGQKTRLSLAQM
    USA300_FPR3757  KTHMSRYESLSNQFEQLEGYQYESKIKTVLYGLNFSEEDFNKPINDFSGGQKTRLSLAQM
                    ******************************:*****************************

    COL             LLNEPDLLLLDEPTNHLDLETTKWLEDYLRYFKGAIVIISHDRYFLDKIVTQIYDVALGD
    N315            LLNEPDLLLLDEPTNHLDLETTKWLEDYLRYFKGAIVIISHDRYFLDKIVTQIYDVALGD
    NCTC8325        LLNEPDLLLLDEPTNHLDLETTKWLEDYLRYFKGAIVIISHDRYFLDKIVTQIYDVALGD
    Newman          LLNEPDLLLLDEPTNHLDLETTKWLEDYLRYFKGAIVIISHDRYFLDKIVTQIYDVALGD
    USA300_FPR3757  LLNEPDLLLLDEPTNHLDLETTKWLEDYLRYFKGAIVIISHDRYFLDKIVTQIYDVALGD
                    ************************************************************

    COL             VKRYVGNYEEFIQQRDLYYQKRMQEYESQQAEIKRLETFVEKNITRASTSGMAKSRRKIL
    N315            VKRYVGNYEEFIQQRDLYYQKRMQEYESQQAEIKRLETFVEKNITRASTSGMAKSRRKIL
    NCTC8325        VKRYVGNYEEFIQQRDLYYQKRMQEYESQQAEIKRLETFVEKNITRASTSGMAKSRRKIL
    Newman          VKRYVGNYEEFIQQRDLYYQKRMQEYESQQAEIKRLETFVEKNITRASTSGMAKSRRKIL
    USA300_FPR3757  VKRYVGNYEEFIQQRDLYYQKRMQEYESQQAEIKRLETFVEKNITRASTSGMAKSRRKIL
                    ************************************************************

    COL             EKMERIDKPMLDAKSANIQFGFDRNTGNDVMHVKNLEIGYQTAITKPMSIEVSKGDHIAI
    N315            EKMERIDKPMLDAKSANIQFGFDRNTGNDVMHVKNLEIGYQTAITKPISIEVSKGDHIAI
    NCTC8325        EKMERIDKPMLDAKSANIQFGFDRNTGNDVMHVKNLEIGYQTAITKPMSIEVSKGDHIAI
    Newman          EKMERIDKPMLDAKSANIQFGFDRNTGNDVMHVKNLEIGYQTAITKPMSIEVSKGDHIAI
    USA300_FPR3757  EKMERIDKPMLDAKSANIQFGFDRNTGNDVMHVKNLEIGYQTAITKPMSIEVSKGDHIAI
                    ***********************************************:************

    COL             IGPNGIGKSTLIKTIANQQKALNGDITFGANLQIGYYDQKQAEFKSSKTILDYVWDQYPL
    N315            IGPNGIGKSTLIKTIANQQKALNGDITFGANLQIGYYDQKQAEFKSSKTILDYVWDQYPL
    NCTC8325        IGPNGIGKSTLIKTIANQQKALNGDITFGANLQIGYYDQKQAEFKSSKTILDYVWDQYPL
    Newman          IGPNGIGKSTLIKTIANQQKALNGDITFGANLQIGYYDQKQAEFKSSKTILDYVWDQYPL
    USA300_FPR3757  IGPNGIGKSTLIKTIANQQKALNGDITFGANLQIGYYDQKQAEFKSSKTILDYVWDQYPL
                    ************************************************************

    COL             MNEKDIRAVLGRFLFVQDDVKKIINDLSGGEKARLLLALLMLQRDNVLILDEPTNHLDID
    N315            MNEKDIRAVLGRFLFVQDDVKKIINDLSGGEKARLQLALLMLQRDNVLILDEPTNHLDID
    NCTC8325        MNEKDIRAVLGRFLFVQDDVKKIINDLSGGEKARLQLALLMLQRDNVLILDEPTNHLDID
    Newman          MNEKDIRAVLGRFLFVQDDVKKIINDLSGGEKARLLLALLMLQRDNVLILDEPTNHLDID
    USA300_FPR3757  MNEKDIRAVLGRFLFVQDDVKKIINDLSGGEKARLLLALLMLQRDNVLILDEPTNHLDID
                    *********************************** ************************

    COL             SKEMLEQALQHFEGTILFVSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIEKVEEAEA
    N315            SKEMLEQALQHFEGTILFVSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIEKVEEAEA
    NCTC8325        SKEMLEQALQHFEGTILFVSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIEKVEEAEA
    Newman          SKEMLEQALQHFEGTILFVSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIEKVEEAEA
    USA300_FPR3757  SKEMLEQALQHFEGTILFVSHDRYFINQLANKVFDLTIDGGKMYLGDYQYYIEKVEEAEA
                    ************************************************************

    COL             LKAHQEEQSVNVQAHKKSMEQSSYHNQKEQRREQRKLERQISECENEIETLETTILQIDE
    N315            LKAHQEEQSVNVQAHKKSMEQSSYHNQKEQRREQRKLERQISECENEIETLETTILQIDE
    NCTC8325        LKAHQEEQSVNVQAHKKSMEQSSYHNQKEQRREQRKLERQISECENEIETLETTILQIDE
    Newman          LKAHQEEQSVNVQAHKKSMEQSSYHNQKEQRREQRKLERQISECENEIETLETTILQIDE
    USA300_FPR3757  LKAHQEEQSVNVQAHKKSMEQSSYHNQKEQRREQRKLERQISECENEIETLETTILQIDE
                    ************************************************************

    COL             QLTQPEVYNNPQKANELAIQKQDSEQKLEHAMSKWEELQQKL
    N315            QLTQPEVYNNPQKANELAIQKQDSEQKLEHAMSKWEELQQKL
    NCTC8325        QLTQPEVYNNPQKANELAIQKQDSEQKLEHAMSKWEELQQKL
    Newman          QLTQPEVYNNPQKANELAIQKQDSEQKLEHAMSKWEELQQKL
    USA300_FPR3757  QLTQPEVYNNPQKANELAIQKQDSEQKLEHAMSKWEELQQKL
                    ******************************************