From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005300000
  • symbol?:
  • description?: Inactive protein of metal-dependent protease family, putative molecular chaperone

      descriptions from strain specific annotations:

    • Inactive protein of metal-dependent protease family, putative molecular chaperone
    • glycoprotease family protein
    • Peptidase M22, glycoprotease
    • glycoprotein endopeptidase
    • Non-proteolytic protein, peptidase family M22
    • putative metal-dependent protease, putative molecular chaperone
  • strand?: -
  • coordinates?: 5462183..5462845
  • synteny block?: BlockID0041000
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1992
    08BA02176:
    C248_2056
    11819-97:
    MS7_2063 (yeaZ)
    71193:
    ST398NM01_2090
    ECT-R 2:
    ECTR2_1902
    ED133:
    SAOV_2088c
    ED98:
    SAAV_2099
    HO 5096 0412:
    SAEMRSA15_19590
    JH1:
    SaurJH1_2125
    JH9:
    SaurJH9_2088
    JKD6008:
    SAA6008_02089
    JKD6159:
    SAA6159_01964
    LGA251:
    SARLGA251_18540
    M013:
    M013TW_2004
    MRSA252:
    SAR2138
    MSHR1132:
    SAMSHR1132_18730
    MSSA476:
    SAS1956
    Mu3:
    SAHV_2036
    Mu50:
    SAV2051
    MW2:
    MW1975
    RF122:
    SAB1936c
    ST398:
    SAPIG2090
    T0131:
    SAT0131_02204
    TCH60:
    HMPREF0772_11148 (yeaZ)
    TW20:
    SATW20_21910
    USA300_TCH1516:
    USA300HOU_2046
    VC40:
    SAVC_09135

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ---------MNSLLIDTSNQPLSVALMQNDEVLAEITTDSKQNHSVQLMPAISQLFEQSK
    N315            MNKLRRQLSMNSLLIDTSNQPLSVALMQNDEVLAEITTDSKQNHSVQLMPAISQLFEQSK
    NCTC8325        ---------MNSLLIDTSNQPLSVALMQNDEVLAEITTDSKQNHSVQLMPAISQLFEQSK
    Newman          MNKLRRQLSMNSLLIDTSNQPLSVALMQNDEVLAEITTDSKQNHSVQLMPAISQLFEQSK
    USA300_FPR3757  ---------MNSLLIDTSNQPLSVALMQNDEVLAEITTDSKQNHSVQLMPAISQLFEQSK
                             ***************************************************

    COL             IAKQQLDAIIVAEGPGSYTGLRIGVTVAKTLAYALDVKLYGVSSLKALAATIDHTDKLLV
    N315            IAKQQLDAIIVAEGPGSYTGLRIGVTVAKTLAYALDVKLYGVSSLKALAATIDHTDKLLV
    NCTC8325        IAKQQLDAIIVAEGPGSYTGLRIGVTVAKTLAYALDVKLYGVSSLKALAATIDHTDKLLV
    Newman          IAKQQLDAIIVAEGPGSYTGLRIGVTVAKTLAYALDVKLYGVSSLKALAATIDHTDKLLV
    USA300_FPR3757  IAKQQLDAIIVAEGPGSYTGLRIGVTVAKTLAYALDVKLYGVSSLKALAATIDHTDKLLV
                    ************************************************************

    COL             PVFDARRQAVYTGIFQWQNGQLVTILEDQYMSIEALRAFLEDLNQPFIYIGKDTVKLQDE
    N315            PVFDARRQAVYTGIFQWQNGQLVTILEDQYMSIEALRAFLEDLNQPFIYIGKDTIKLQDE
    NCTC8325        PVFDARRQAVYTGIFQWQNGQLVTILEDQYMSIEALRAFLEDLNQPFIYIGKDTVKLQDE
    Newman          PVFDARRQAVYTGMFQWQNGQLVTILEDQYMSIEALRAFLEDLNQPFIYIGKDTVKLQDE
    USA300_FPR3757  PVFDARRQAVYTGIFQWQNGQLVTILEDQYMSIEALRAFLEDLNQPFIYIGKDTVKLQDE
                    *************:****************************************:*****

    COL             LQGEVIAQLPNASVMYQLLDKPSDVHTFTPKYHKLAEAERNWINSQKNN
    N315            LQGEVIAQLPNASVMYQLIDKPTDVHTFTPKYHKLAEAERNWINSQKNN
    NCTC8325        LQGEVIAQLPNASVMYQLLDKPSDVHTFTPKYHKLAEAERNWINSQKNN
    Newman          LQGEVIAQLPNASVMYQLLDKPSDVHTFTPKYHKLAEAERNWINSQKNN
    USA300_FPR3757  LQGEVIAQLPNASVMYQLLDKPSDVHTFTPKYHKLAEAERNWINSQKNN
                    ******************:***:**************************