From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005301000
  • symbol?:
  • description?: ATPase YjeE

      descriptions from strain specific annotations:

    • ATPase YjeE
    • P-loop hydrolase family protein
    • putative ATPase
    • ATP-binding protein
    • ATP/GTP hydrolase
  • strand?: -
  • coordinates?: 5462826..5463260
  • synteny block?: BlockID0041010
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1993 (yjeE)
    08BA02176:
    C248_2057
    11819-97:
    MS7_2064
    71193:
    ST398NM01_2091
    ECT-R 2:
    ECTR2_1903
    ED133:
    SAOV_2089c
    ED98:
    SAAV_2100
    HO 5096 0412:
    SAEMRSA15_19600
    JH1:
    SaurJH1_2126
    JH9:
    SaurJH9_2089
    JKD6008:
    SAA6008_02090 (yjeE)
    JKD6159:
    SAA6159_01965 (yjeE)
    LGA251:
    SARLGA251_18550
    M013:
    M013TW_2005
    MRSA252:
    SAR2139
    MSHR1132:
    SAMSHR1132_18740
    MSSA476:
    SAS1957
    Mu3:
    SAHV_2037
    Mu50:
    SAV2052
    MW2:
    MW1976
    RF122:
    SAB1937c
    ST398:
    SAPIG2091
    T0131:
    SAT0131_02205 (mnhG)
    TCH60:
    HMPREF0772_11147
    TW20:
    SATW20_21920
    USA300_TCH1516:
    USA300HOU_2047
    VC40:
    SAVC_09140

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             --------------------MNQFAIFLVEQLKSGDLILLNGDLGAGKTTLTQFIGKALG
    N315            -----------MIKINNLDEMNQFAMFLVEQLKSGDLILLNGDLGAGKTTLTQFIGKALG
    NCTC8325        --------------------MNQFAIFLVEQLKSGDLILLNGDLGAGKTTLTQFIGKALG
    Newman          MNEKHNIGESTLIKINNLDEMNQFAIFLVEQLKSGDLILLNGDLGAGKTTLTQFIGKALG
    USA300_FPR3757  --------------------MNQFAIFLVEQLKSGDLILLNGDLGAGKTTLTQFIGKALG
                                        *****:**********************************

    COL             VRRTINSPTFNIIKSYRGKNLKLHHMDCYRLEDSDEDLGFDEFFEDQAITVIEWSQFIKD
    N315            VRRTINSPTFNIIKSYRGKNLKLHHMDCYRLEDSDEDLGFDEFFEDQAITVIEWSQFIKD
    NCTC8325        VRRTINSPTFNIIKSYRGKNLKLHHMDCYRLEDSDEDLGFDEFFEDQAITVIEWSQFIKD
    Newman          VRRTINSPTFNIIKSYRGKNLKLHHMDCYRLEDSDEDLGFDEFFEDQAITVIEWSQFIKD
    USA300_FPR3757  VRRTINSPTFNIIKSYRGKNLKLHHMDCYRLEDSDEDLGFDEFFEDQAITVIEWSQFIKD
                    ************************************************************

    COL             LLPATHLSINISTISENTRQIELFAQGEHYEQIKEAIIHEFAAH
    N315            LLPATHLSINISTISENTRQIELFAQGEHYEQIKEAIIHEFAAH
    NCTC8325        LLPATHLSINISTISENTRQIELFAQGEHYEQIKEAIIHEFAAH
    Newman          LLPATHLSINISTISENTRQIELFAQGEHYEQIKEAIIHEFAAH
    USA300_FPR3757  LLPATHLSINISTISENTRQIELFAQGEHYEQIKEAIIHEFAAH
                    ********************************************