From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005331000
  • symbol?:
  • description?: transcription accessory protein

      descriptions from strain specific annotations:

    • transcription accessory protein
    • RNA-binding S1 domain-containing protein
    • S1 RNA-binding domain-containing protein
    • Transcription accessory protein (S1 RNA-binding domain)
    • RNA-binding protein
    • putative RNA binding protein
    • transcription accessory protein (S1 RNA binding)
    • YhgF like protein
    • protein YhgF
  • strand?: -
  • coordinates?: 5507862..5510000
  • synteny block?: BlockID0041280
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2004
    08BA02176:
    C248_2074
    11819-97:
    MS7_2080
    71193:
    ST398NM01_2104
    ECT-R 2:
    ECTR2_1919
    ED133:
    SAOV_2105c
    ED98:
    SAAV_2115
    HO 5096 0412:
    SAEMRSA15_19730
    JH1:
    SaurJH1_2137
    JH9:
    SaurJH9_2100
    JKD6008:
    SAA6008_02102 (tex)
    JKD6159:
    SAA6159_01978 (tex)
    LGA251:
    SARLGA251_18660
    M013:
    M013TW_2022
    MRSA252:
    SAR2151
    MSHR1132:
    SAMSHR1132_18880
    MSSA476:
    SAS1968
    Mu3:
    SAHV_2048
    Mu50:
    SAV2063
    MW2:
    MW1987
    RF122:
    SAB1948c
    ST398:
    SAPIG2104
    T0131:
    SAT0131_02220 (mnhC)
    TCH60:
    HMPREF0772_11132 (yhgF)
    TW20:
    SATW20_22030
    USA300_TCH1516:
    USA300HOU_2058
    VC40:
    SAVC_09195

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MDNQLINSIIEKYQFSKKQIEAVLTLLEEKNTVPFIARYRKEQTGGLDEVQIKQIDDEYQ
    N315            MDNQLINSIIEKYQFSKKQIEAVLTLLEEKNTVPFIARYRKEQTGGLDEVQIKQIDDEYQ
    NCTC8325        MDNQLINSIIEKYQFSKKQIEAVLTLLEEKNTVPFIARYRKEQTGGLDEVQIKQIDDEYQ
    Newman          MDNQLINSIIEKYQFSKKQIEAVLTLLEEKNTVPFIARYRKEQTGGLDEVQIKQIDDEYQ
    USA300_FPR3757  MDNQLINSIIEKYQFSKKQIEAVLTLLEEKNTVPFIARYRKEQTGGLDEVQIKQIDDEYQ
                    ************************************************************

    COL             YMVNLQKRKEEVIKNIEQQGLLTEELKKDILKQNKLQRVEDLYRPFKQKKKTRATEAKRK
    N315            YMVNLQKRKEEVIKNIEQQGLLTEELKKDILKQNKLQRVEDLYRPFKQKKKTRATEAKRK
    NCTC8325        YMVNLQKRKEEVIKNIEQQGLLTEELKKDILKQNKLQRVEDLYRPFKQKKKTRATEAKRK
    Newman          YMVNLQKRKEEVIKNIEQQGLLTEELKKDILKQNKLQRVEDLYRPFKQKKKTRATEAKRK
    USA300_FPR3757  YMVNLQKRKEEVIKNIEQQGLLTEELKKDILKQNKLQRVEDLYRPFKQKKKTRATEAKRK
                    ************************************************************

    COL             GLEPLAIWMKARKHEVSIEEKAQQFINEEVQSVEDAIKGAQDIIAEQISDNPKYRTKILK
    N315            GLEPLAIWMKARKHEVSIEEKAQQFINEEVQSVEDAIKGAQDIIAEQISDNPKYRTKILK
    NCTC8325        GLEPLAIWMKARKHEVSIEEKAQQFINEEVQSVEDAIKGAQDIIAEQISDNPKYRTKILK
    Newman          GLEPLAIWMKARKHEVSIEEKAQQFINEEVQSVEDAIKGAQDIIAEQISDNPKYRTKILK
    USA300_FPR3757  GLEPLAIWMKARKHEVSIEEKAQQFINEEVQSVEDAIKGAQDIIAEQISDNPKYRTKILK
                    ************************************************************

    COL             DMYHQGVLTTSKKKNAEDEKGIFEMYYAYSEPIKRIANHRVLAVNRGEKEKVLSVKFEFD
    N315            DMYHQGVLTTSKKKNAEDEKGIFEMYYAYSEPIKRIANHRVLAVNRGEKEKVLSVKFEFD
    NCTC8325        DMYHQGVLTTSKKKNAEDEKGIFEMYYAYSEPIKRIANHRVLAVNRGEKEKVLSVKFEFD
    Newman          DMYHQGVLTTSKKKNAEDEKGIFEMYYAYSEPIKRIANHRVLAVNRGEKEKVLSVKFEFD
    USA300_FPR3757  DMYHQGVLTTSKKKNAEDEKGIFEMYYAYSEPIKRIANHRVLAVNRGEKEKVLSVKFEFD
                    ************************************************************

    COL             TTSVEDFIARQEINHNNVNRSYILEAIKDSLKRLIVPSIEREIHADLTEKAENHAIDVFS
    N315            TTSVEDFIARQEINHNNVNRSYILEAIKDSLKRLIVPSIEREIHADLTEKAENHAIDVFS
    NCTC8325        TTSVEDFIARQEINHNNVNRSYILEAIKDSLKRLIVPSIEREIHADLTEKAENHAIDVFS
    Newman          TTSVEDFIARQEINHNNVNRSYILEAIKDSLKRLIVPSIEREIHADLTEKAENHAIDVFS
    USA300_FPR3757  TTSVEDFIARQEINHNNVNRSYILEAIKDSLKRLIVPSIEREIHADLTEKAENHAIDVFS
                    ************************************************************

    COL             ENLRNLLLQPPMKGKQILGVDPAFRTGCKLAVINPFGTFIAKGVIYPHPPVSKKEAAEKD
    N315            ENLRNLLLQPPMKGKQILGVDPAFRTGCKLAVINPFGTFIAKGVIYPHPPVSKKEAAEKD
    NCTC8325        ENLRNLLLQPPMKGKQILGVDPAFRTGCKLAVINPFGTFIAKGVIYPHPPVSKKEAAEKD
    Newman          ENLRNLLLQPPMKGKQILGVDPAFRTGCKLAVINPFGTFIAKGVIYPHPPVSKKEAAEKD
    USA300_FPR3757  ENLRNLLLQPPMKGKQILGVDPAFRTGCKLAVINPFGTFIAKGVIYPHPPVSKKEAAEKD
                    ************************************************************

    COL             FVQMVKAYDVQLIAIGNGTASRETEQFVADLIKKHQLPVQFIIVNEAGASVYSASEIARD
    N315            FVQMVKAYDVQLIAIGNGTASRETEQFVADLIKKHQLPVQFIIVNEAGASVYSASEIARD
    NCTC8325        FVQMVKAYDVQLIAIGNGTASRETEQFVADLIKKHQLPVQFIIVNEAGASVYSASEIARD
    Newman          FVQMVKAYDVQLIAIGNGTASRETEQFVADLIKKHQLPVQFIIVNEAGASVYSASEIARD
    USA300_FPR3757  FVQMVKAYDVQLIAIGNGTASRETEQFVADLIKKHQLPVQFIIVNEAGASVYSASEIARD
                    ************************************************************

    COL             EFPDFQVEERSAVSIGRRVQDPLSELVKIDPKSIGVGQYQHDVNQKALENALTFVVETAV
    N315            EFPDFQVEERSAVSIGRRVQDPLSELVKIDPKSIGVGQYQHDVNQKALENALTFVVETAV
    NCTC8325        EFPDFQVEERSAVSIGRRVQDPLSELVKIDPKSIGVGQYQHDVNQKALENALTFVVETAV
    Newman          EFPDFQVEERSAVSIGRRVQDPLSELVKIDPKSIGVGQYQHDVNQKALENALTFVVETAV
    USA300_FPR3757  EFPDFQVEERSAVSIGRRVQDPLSELVKIDPKSIGVGQYQHDVNQKALENALTFVVETAV
                    ************************************************************

    COL             NQVGVDVNTASSSLLQYVSGLSSQIAKNIIAYREENGAIKHNKELSKIKRLGAKTFEQSI
    N315            NQVGVDVNTASSSLLQYVSGLSSQIAKNIIAYREENGAIKHNKELSKIKRLGAKTFEQSI
    NCTC8325        NQVGVDVNTASSSLLQYVSGLSSQIAKNIIAYREENGAIKHNKELSKIKRLGAKTFEQSI
    Newman          NQVGVDVNTASSSLLQYVSGLSSQIAKNIIAYREENGAIKHNKELSKIKRLGAKTFEQSI
    USA300_FPR3757  NQVGVDVNTASSSLLQYVSGLSSQIAKNIIAYREENGAIKHNKELSKIKRLGAKTFEQSI
                    ************************************************************

    COL             GFLRIVDGSEPLDNTSIHPESYKVTYQLLDKLGFGGNDLGSDALKAKLNSLDMDELAIEL
    N315            GFLRIVDGSEPLDNTSIHPESYKVTYQLLDKLGFGGNDLGSDALKAKLNSLDMDELAIEL
    NCTC8325        GFLRIVDGSEPLDNTSIHPESYKVTYQLLDKLGFGGNDLGSDALKAKLNSLDMDELAIEL
    Newman          GFLRIVDGSEPLDNTSIHPESYKVTYQLLDKLGFGGNDLGSDALKAKLNSLDMDELAIEL
    USA300_FPR3757  GFLRIVDGSEPLDNTSIHPESYKVTYQLLDKLGFGGNDLGSDALKAKLNSLDMDELAIEL
                    ************************************************************

    COL             QVGVPTLEDIIKSLKAPNRDPRDEFETPILKSDVLSIEDLQEGMKLSGTVRNVVDFGAFV
    N315            QVGVPTLEDIIKSLKAPNRDPRDEFDTPILKSDVLSIEDLKEGMKLSGTVRNVVDFGAFV
    NCTC8325        QVGVPTLEDIIKSLKAPNRDPRDEFETPILKSDVLSIEDLQEGMKLSGTVRNVVDFGAFV
    Newman          QVGVPTLEDIIKSLKAPNRDPRDEFETPILKSDVLSIEDLQEGMKLSGTVRNVVDFGAFV
    USA300_FPR3757  QVGVPTLEDIIKSLKAPNRDPRDEFETPILKSDVLSIEDLQEGMKLSGTVRNVVDFGAFV
                    *************************:**************:*******************

    COL             DIGVKQDGLVHVSKLSKKFVKNPMDIVSVGDIVDVWIYSIDKNKDKVSLTMIDPHE
    N315            DIGVKQDGLVHVSKLSKKFVKNPMDIVSVGDIVDVWVYSIDKNKDKVSLTMIDPHE
    NCTC8325        DIGVKQDGLVHVSKLSKKFVKNPMDIVSVGDIVDVWIYSIDKNKDKVSLTMIDPHE
    Newman          DIGVKQDGLVHVSKLSKKFVKNPMDIVSVGDIVDVWIYSIDKNKDKVSLTMIDPHE
    USA300_FPR3757  DIGVKQDGLVHVSKLSKKFVKNPMDIVSVGDIVDVWIYSIDKNKDKVSLTMIDPHE
                    ************************************:*******************