From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005334000
  • symbol?: rsbW
  • description?: serine-protein kinase RsbW

      descriptions from strain specific annotations:

    • serine-protein kinase RsbW
    • anti-sigma-B factor, serine-protein kinase
    • anti-sigma B factor
  • strand?: -
  • coordinates?: 5512742..5513221
  • synteny block?: BlockID0041310
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2055 (rsbW)
    N315:
    SA1870 (rsbW)
    NCTC8325:
    Newman:
    NWMN_1971 (rsbW)
    USA300_FPR3757:
    04-02981:
    SA2981_2006 (rsbW)
    08BA02176:
    C248_2076 (rsbW)
    11819-97:
    MS7_2082 (rsbW)
    71193:
    ST398NM01_2106
    ECT-R 2:
    ECTR2_1921 (rsbW)
    ED133:
    SAOV_2107c (rsbW)
    ED98:
    SAAV_2118 (rsbW)
    HO 5096 0412:
    SAEMRSA15_19750 (rsbW)
    JH1:
    SaurJH1_2139
    JH9:
    SaurJH9_2102
    JKD6008:
    SAA6008_02104 (rsbW)
    JKD6159:
    SAA6159_01980 (rsbW)
    LGA251:
    SARLGA251_18680 (rsbW)
    M013:
    M013TW_2024
    MRSA252:
    SAR2153 (rsbW)
    MSHR1132:
    SAMSHR1132_18900
    MSSA476:
    SAS1970
    Mu3:
    SAHV_2050 (rsbW)
    Mu50:
    SAV2065 (rsbW)
    MW2:
    MW1989 (rsbW)
    RF122:
    SAB1950c (rsbW)
    ST398:
    SAPIG2106 (rsbW)
    T0131:
    SAT0131_02222 (mnhA)
    TCH60:
    HMPREF0772_11130 (rsbW)
    TW20:
    SATW20_22050 (rsbW)
    USA300_TCH1516:
    USA300HOU_2060 (rsbW)
    VC40:
    SAVC_09205

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ----------MQSKEDFIEMRVPASAEYVSLIRLTLSGVFSRAGATYDDIEDAKIAVSEA
    N315            ----------MQSKEDFIEMRVPASAEYVSLIRLTLSGVFSRAGATYDDIEDAKIAVSEA
    NCTC8325        MLMKERRSNNMQSKEDFIEMRVPASAEYVSLIRLTLSGVFSRAGATYDDIEDAKIAVSEA
    Newman          ----------MQSKEDFIEMRVPASAEYVSLIRLTLSGVFSRAGATYDDIEDAKIAVSEA
    USA300_FPR3757  ----------MQSKEDFIEMRVPASAEYVSLIRLTLSGVFSRAGATYDDIEDAKIAVSEA
                              **************************************************

    COL             VTNAVKHAYKENNNVGIINIYFEILEDKIKIVISDKGDSFDYETTKSKIGPYDKDENIDF
    N315            VTNAVKHAYKENNNVGIINIYFEILEDKIKIVISDKGDSFDYETTKSKIGPYDKDENIDF
    NCTC8325        VTNAVKHAYKENNNVGIINIYFEILEDKIKIVISDKGDSFDYETTKSKIGPYDKDENIDF
    Newman          VTNAVKHAYKENNNVGIINIYFEILEDKIKIVISDKGDSFDYETTKSKIGPYDKDENIDF
    USA300_FPR3757  VTNAVKHAYKENNNVGIINIYFEILEDKIKIVISDKGDSFDYETTKSKIGPYDKDENIDF
                    ************************************************************

    COL             LREGGLGLFLIESLMDEVTVYKESGVTISMTKYIKKEQVRNNGERVEIS
    N315            LREGGLGLFLIESLMDEVTVYKESGVTISMTKYIKKEQVRNNGERVEIS
    NCTC8325        LREGGLGLFLIESLMDEVTVYKESGVTISMTKYIKKEQVRNNGERVEIS
    Newman          LREGGLGLFLIESLMDEVTVYKESGVTISMTKYIKKEQVRNNGERVEIS
    USA300_FPR3757  LREGGLGLFLIESLMDEVTVYKESGVTISMTKYIKKEQVRNNGERVEIS
                    *************************************************