From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005339000
  • symbol?: mazF
  • description?: PemK family protein

      descriptions from strain specific annotations:

    • PemK family protein
    • transcriptional modulator of MazE/toxin MazF
    • Programmed cell death toxin YdcE
    • chpK
    • PemK family DNA-binding protein
    • PemK family transcriptional regulator
    • Toxin MazF
    • mRNA interferase MazF
    • endoribonuclease EndoA
    • PemK-like protein
  • strand?: -
  • coordinates?: 5515021..5515383
  • synteny block?: BlockID0041360
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2009 (ydcE)
    08BA02176:
    C248_2080
    11819-97:
    MS7_2085 (mazF)
    71193:
    ST398NM01_2109
    ECT-R 2:
    ECTR2_1924
    ED133:
    SAOV_2110c
    ED98:
    SAAV_2121
    HO 5096 0412:
    SAEMRSA15_19780
    JH1:
    SaurJH1_2143
    JH9:
    SaurJH9_2105
    JKD6008:
    SAA6008_02107 (mazF)
    JKD6159:
    SAA6159_01983 (mazF)
    LGA251:
    SARLGA251_18710
    M013:
    M013TW_2027
    MRSA252:
    SAR2156
    MSHR1132:
    SAMSHR1132_18930
    MSSA476:
    SAS1973
    Mu3:
    SAHV_2053
    Mu50:
    SAV2068
    MW2:
    MW1992
    RF122:
    SAB1953c
    ST398:
    SAPIG2109
    T0131:
    SAT0131_02225
    TCH60:
    HMPREF0772_11127
    TW20:
    SATW20_22080
    USA300_TCH1516:
    USA300HOU_2063 (pemK)
    VC40:
    SAVC_09225

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVE
    N315            MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVE
    NCTC8325        MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVE
    Newman          MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVE
    USA300_FPR3757  MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVE
                    ************************************************************

    COL             IEKKKYKLDKDSVILLEQIRTLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
    N315            IEKKKYKLDKDSVILLEQIRTLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
    NCTC8325        IEKKKYKLDKDSVILLEQIRTLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
    Newman          IEKKKYKLDKDSVILLEQIRTLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
    USA300_FPR3757  IEKKKYKLDKDSVILLEQIRTLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
                    ************************************************************