From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005349000
  • symbol?: kdpA
  • description?: potassium-transporting ATPase subunit A

      descriptions from strain specific annotations:

    • potassium-transporting ATPase subunit A
    • Potassium-transporting ATPase A chain
    • K+-transporting ATPase, A subunit
    • putative potassium-transporting ATPase a chain
    • P-ATPase superfamily P-type ATPase potassium (K+) transporter subunit A
  • strand?: -
  • coordinates?: 5522817..5524376
  • synteny block?: BlockID0041460
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2068 (kdpA)
    N315:
    SA1881 (kdpA)
    NCTC8325:
    Newman:
    NWMN_1982 (kdpA)
    USA300_FPR3757:
    04-02981:
    SA2981_2018 (kdpA)
    08BA02176:
    C248_2089 (kdpA)
    11819-97:
    MS7_2094 (kdpA)
    71193:
    ST398NM01_2118
    ECT-R 2:
    ECTR2_1933 (kdpA)
    ED133:
    SAOV_2119c
    ED98:
    SAAV_2131 (kdpA)
    HO 5096 0412:
    SAEMRSA15_19870 (kdpA)
    JH1:
    SaurJH1_2152
    JH9:
    SaurJH9_2114
    JKD6008:
    SAA6008_02116 (kdpA)
    JKD6159:
    SAA6159_01992 (kdpA)
    LGA251:
    SARLGA251_18800 (kdpA)
    M013:
    M013TW_2036
    MRSA252:
    SAR2165 (kdpA)
    MSHR1132:
    SAMSHR1132_19020
    MSSA476:
    SAS1982
    Mu3:
    SAHV_2062 (kdpA)
    Mu50:
    SAV2077 (kdpA)
    MW2:
    MW2001 (kdpA)
    RF122:
    SAB1962c (kdpA)
    ST398:
    SAPIG2118 (kdpA)
    T0131:
    SAT0131_02236
    TCH60:
    HMPREF0772_11118 (kdpA)
    TW20:
    SATW20_22170 (kdpA)
    USA300_TCH1516:
    USA300HOU_2072 (kdpA)
    VC40:
    SAVC_09270

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MEIILFLTMMVMITYVFSGYLYRVALVQSSRVDLIFTRFENMCFKIIGTDLEHMSAKTYV
    N315            MEIILFLTMMVMITYVFSGYLYRVALVQSSRVDLIFTRFENMCFKIIGTDLEHMSAKTYV
    NCTC8325        MEIILFLTMMVMITYVFSGYLYRVALVQSSRVDLIFTRFENMCFKIIGTDLEHMSAKTYV
    Newman          MEIILFLTMMVMITYVFSGYLYRVALVQSSRVDLIFTRFENMCFKIIGTDLEHMSAKTYV
    USA300_FPR3757  MEIILFLTMMVMITYVFSGYLYRVALVQSSRVDLIFTRFENMCFKIIGTDLEHMSAKTYV
                    ************************************************************

    COL             KHFLAFNGFMGFITFVLLIVQQWLFLNPNHNLNQSIDLAFNTAISFLTNSNLQHYNGESD
    N315            KHFLAFNGFMGFITFVLLIVQQWLFLNPNHILNQSIDLAFNTAISFLTNSNLQHYNGESD
    NCTC8325        KHFLAFNGFMGFITFVLLIVQQWLFLNPNHNLNQSIDLAFNTAISFLTNSNLQHYNGESD
    Newman          KHFLAFNGFMGFITFVLLIVQQWLFLNPNHNLNQSIDLAFNTAISFLTNSNLQHYNGESD
    USA300_FPR3757  KHFLAFNGFMGFITFVLLIVQQWLFLNPNHNLNQSIDLAFNTAISFLTNSNLQHYNGESD
                    ****************************** *****************************

    COL             VTYLTQMIVMTYLMFTSSASGYAVCIAMLRRLTGLTNIIGNFYQDIVRFIVRVLLPLSCL
    N315            VTYLTQMIVMTYLMFTSSASGYAVCIAMLRRLTGLTNIIGNFYQDIVRFIVRVLLPLSCL
    NCTC8325        VTYLTQMIVMTYLMFTSSASGYAVCIAMLRRLTGLTNIIGNFYQDIVRFIVRVLLPLSCL
    Newman          VTYLTQMIVMTYLMFTSSASGYAVCIAMLRRLTGLTNIIGNFYQDIVRFIVRVLLPLSCL
    USA300_FPR3757  VTYLTQMIVMTYLMFTSSASGYAVCIAMLRRLTGLTNIIGNFYQDIVRFIVRVLLPLSCL
                    ************************************************************

    COL             ISILLMTQGVPQTLHANLMIRTLSGHIQHIAFGPIASLESIKHLGTNGGGFLAGNSATPF
    N315            ISILLMTQGVPQTLHANLMIRTLSGHIQHIAFGPIASLESIKHLGTNGGGFLAGNSATPF
    NCTC8325        ISILLMTQGVPQTLHANLMIRTLSGHIQHIAFGPIASLESIKHLGTNGGGFLAGNSATPF
    Newman          ISILLMTQGVPQTLHANLMIRTLSGHIQHIAFGPIASLESIKHLGTNGGGFLAGNSATPF
    USA300_FPR3757  ISILLMTQGVPQTLHANLMIRTLSGHIQHIAFGPIASLESIKHLGTNGGGFLAGNSATPF
                    ************************************************************

    COL             ENPNIWSNFIEMGSMMLLPMSMLFLFGRMLSRHGKRVHRHALILFVAMFFIFIAILTLTM
    N315            ENPNIWSNFIEMGSMMLLPMSMLFLFGRMLSRHGKRVHRHALILFVAMFFIFIAILTLTM
    NCTC8325        ENPNIWSNFIEMGSMMLLPMSMLFLFGRMLSRHGKRVHRHALILFVAMFFIFIAILTLTM
    Newman          ENPNIWSNFIEMGSMMLLPMSMLFLFGRMLSRHGKRVHRHALILFVAMFFIFIAILTLTM
    USA300_FPR3757  ENPNIWSNFIEMGSMMLLPMSMLFLFGRMLSRHGKRVHRHALILFVAMFFIFIAILTLTM
                    ************************************************************

    COL             WSEYRGNPILANLGIYGPNMEGKEVRFGAGLSALFTVITTAFTTGSVNNMHDSLTPIGGL
    N315            WSEYRGNPILANLGIYGPNMEGKEVRFGAGLSALFTVITTAFTTGSVNNMHDSLTPIGGL
    NCTC8325        WSEYRGNPILANLGIYGPNMEGKEVRFGAGLSALFTVITTAFTTGSVNNMHDSLTPIGGL
    Newman          WSEYRGNPILANLGIYGPNMEGKEVRFGAGLSALFTVITTAFTTGSVNNMHDSLTPIGGL
    USA300_FPR3757  WSEYRGNPILANLGIYGPNMEGKEVRFGAGLSALFTVITTAFTTGSVNNMHDSLTPIGGL
                    ************************************************************

    COL             GPMVLMMLNVVFGGEGVGLMNLLIFVLLTVFICSLMVGKTPEYLNMPIGAREMKCIVLVF
    N315            GPMVLMMLNVVFGGEGVGLMNLLIFVLLTVFICSLMVGKTPEYLNMPIGAREMKCIVLVF
    NCTC8325        GPMVLMMLNVVFGGEGVGLMNLLIFVLLTVFICSLMVGKTPEYLNMPIGAREMKCIVLVF
    Newman          GPMVLMMLNVVFGGEGVGLMNLLIFVLLTVFICSLMVGKTPEYLNMPIGAREMKCIVLVF
    USA300_FPR3757  GPMVLMMLNVVFGGEGVGLMNLLIFVLLTVFICSLMVGKTPEYLNMPIGAREMKCIVLVF
                    ************************************************************

    COL             LIHPILILVFSALAFMIPGASESITNPSFHGISQVMYEMTSAAANNGSGFEGLKDDTTFW
    N315            LIHPILILVFSALAFMIPGASESITNPSFHGISQVMYEMTSAAANNGSGFEGLKDDTTFW
    NCTC8325        LIHPILILVFSALAFMIPGASESITNPSFHGISQVMYEMTSAAANNGSGFEGLKDDTTFW
    Newman          LIHPILILVFSALAFMIPGASESITNPSFHGISQVMYEMTSAAANNGSGFEGLKDDTTFW
    USA300_FPR3757  LIHPILILVFSALAFMIPGASESITNPSFHGISQVMYEMTSAAANNGSGFEGLKDDTTFW
                    ************************************************************

    COL             NISTGIIMLLSRYIPIILQLMIASSLVNKKSYHQDKYTIAIDKPYFGVSLIVFIVLLSGL
    N315            NISTGIIMLLSRYIPIILQLMIASSLVNKKSYHQDKYTIAIDKPYFGVSLIVFIVLLSGL
    NCTC8325        NISTGIIMLLSRYIPIILQLMIASSLVNKKSYHQDKYTIAIDKPYFGVSLIVFIVLLSGL
    Newman          NISTGIIMLLSRYIPIILQLMIASSLVNKKSYHQDKYTIAIDKPYFGVSLIVFIVLLSGL
    USA300_FPR3757  NISTGIIMLLSRYIPIILQLMIASSLVNKKSYHQDKYTIAIDKPYFGVSLIVFIVLLSGL
                    ************************************************************

    COL             TFIPVLLLGPIGEFLTLK
    N315            TFIPVLLLGPIGEFLTLK
    NCTC8325        TFIPVLLLGPIGEFLTLK
    Newman          TFIPVLLLGPIGEFLTLK
    USA300_FPR3757  TFIPVLLLGPIGEFLTLK
                    ******************