From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005354000
  • symbol?: cshA
  • description?: DEAD/DEAH box family ATP-dependent RNA helicase

      descriptions from strain specific annotations:

    • DEAD/DEAH box family ATP-dependent RNA helicase
    • DEAD/DEAH box helicase
    • DEAD-box ATP dependent DNA helicase
    • ATP-dependent RNA helicase DEAD box family protein
    • ATP-dependent RNA helicase
    • Cold-shock DEAD-box protein A
    • cold-shock deAd box protein a (atp-dependent rna helicasedead)
    • DEAD-box ATP-dependent RNA helicase
    • putative helicase
  • strand?: -
  • coordinates?: 5530151..5531614
  • synteny block?: BlockID0041510
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2022
    08BA02176:
    C248_2092
    11819-97:
    MS7_2097 (cshA)
    71193:
    ST398NM01_2122
    ECT-R 2:
    ECTR2_1937
    ED133:
    SAOV_2122c
    ED98:
    SAAV_2135
    HO 5096 0412:
    SAEMRSA15_19900
    JH1:
    SaurJH1_2156
    JH9:
    SaurJH9_2118
    JKD6008:
    SAA6008_02119
    JKD6159:
    SAA6159_01995
    LGA251:
    SARLGA251_18830
    M013:
    M013TW_2039
    MRSA252:
    SAR2168
    MSHR1132:
    SAMSHR1132_19050
    MSSA476:
    SAS1985
    Mu3:
    SAHV_2066
    Mu50:
    SAV2081
    MW2:
    MW2004
    RF122:
    SAB1965c
    ST398:
    SAPIG2122
    T0131:
    SAT0131_02239 (spsA)
    TCH60:
    HMPREF0772_11114
    TW20:
    SATW20_22200
    USA300_TCH1516:
    USA300HOU_2076
    VC40:
    SAVC_09285

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MQNFKELGISDNTVQSLESMGFKEPTPIQKDSIPYALQGIDILGQAQTGTGKTGAFGIPL
    N315            MQNFKELGISDNTVQSLESMGFKEPTPIQKDSIPYALQGIDILGQAQTGTGKTGAFGIPL
    NCTC8325        MQNFKELGISDNTVQSLESMGFKEPTPIQKDSIPYALQGIDILGQAQTGTGKTGAFGIPL
    Newman          MQNFKELGISDNTVQSLESMGFKEPTPIQKDSIPYALQGIDILGQAQTGTGKTGAFGIPL
    USA300_FPR3757  MQNFKELGISDNTVQSLESMGFKEPTPIQKDSIPYALQGIDILGQAQTGTGKTGAFGIPL
                    ************************************************************

    COL             IEKVVGKQGVQSLILAPTRELAMQVAEQLREFSRGQGVQVVTVFGGMPIERQIKALKKGP
    N315            IEKVVGKQGVQSLILAPTRELAMQVAEQLREFSRGQGVQVVTVFGGMPIERQIKALKKGP
    NCTC8325        IEKVVGKQGVQSLILAPTRELAMQVAEQLREFSRGQGVQVVTVFGGMPIERQIKALKKGP
    Newman          IEKVVGKQGVQSLILAPTRELAMQVAEQLREFSRGQGVQVVTVFGGMPIERQIKALKKGP
    USA300_FPR3757  IEKVVGKQGVQSLILAPTRELAMQVAEQLREFSRGQGVQVVTVFGGMPIERQIKALKKGP
                    ************************************************************

    COL             QIVVGTPGRVIDHLNRRTLKTDGIHTLILDEADEMMNMGFIDDMRFIMDKIPAVQRQTML
    N315            QIVVGTPGRVIDHLNRRTLKTDGIHTLILDEADEMMNMGFIDDMRFIMDKIPAVQRQTML
    NCTC8325        QIVVGTPGRVIDHLNRRTLKTDGIHTLILDEADEMMNMGFIDDMRFIMDKIPAVQRQTML
    Newman          QIVVGTPGRVIDHLNRRTLKTDGIHTLILDEADEMMNMGFIDDMRFIMDKIPAVQRQTML
    USA300_FPR3757  QIVVGTPGRVIDHLNRRTLKTDGIHTLILDEADEMMNMGFIDDMRFIMDKIPAVQRQTML
                    ************************************************************

    COL             FSATMPKAIQALVQQFMKSPKIIKTMNNEMSDPQIEEFYTIVKELEKFDTFTNFLDVHQP
    N315            FSATMPKAIQALVQQFMKSPKIIKTMNNEMSDPQIEEFYTIVKELEKFDTFTNFLDVHQP
    NCTC8325        FSATMPKAIQALVQQFMKSPKIIKTMNNEMSDPQIEEFYTIVKELEKFDTFTNFLDVHQP
    Newman          FSATMPKAIQALVQQFMKSPKIIKTMNNEMSDPQIEEFYTIVKELEKFDTFTNFLDVHQP
    USA300_FPR3757  FSATMPKAIQALVQQFMKSPKIIKTMNNEMSDPQIEEFYTIVKELEKFDTFTNFLDVHQP
                    ************************************************************

    COL             ELAIVFGRTKRRVDELTSALISKGYKAEGLHGDITQAKRLEVLKKFKNDQINILVATDVA
    N315            ELAIVFGRTKRRVDELTSALISKGYKAEGLHGDITQAKRLEVLKKFKNDQINILVATDVA
    NCTC8325        ELAIVFGRTKRRVDELTSALISKGYKAEGLHGDITQAKRLEVLKKFKNDQINILVATDVA
    Newman          ELAIVFGRTKRRVDELTSALISKGYKAEGLHGDITQAKRLEVLKKFKNDQINILVATDVA
    USA300_FPR3757  ELAIVFGRTKRRVDELTSALISKGYKAEGLHGDITQAKRLEVLKKFKNDQINILVATDVA
                    ************************************************************

    COL             ARGLDISGVSHVYNFDIPQDTESYTHRIGRTGRAGKEGIAVTFVNPIEMDYIRQIEDANG
    N315            ARGLDISGVSHVYNFDIPQDTESYTHRIGRTGRAGKEGIAVTFVNPIEMDYIRQIEDANG
    NCTC8325        ARGLDISGVSHVYNFDIPQDTESYTHRIGRTGRAGKEGIAVTFVNPIEMDYIRQIEDANG
    Newman          ARGLDISGVSHVYNFDIPQDTESYTHRIGRTGRAGKEGIAVTFVNPIEMDYIRQIEDANG
    USA300_FPR3757  ARGLDISGVSHVYNFDIPQDTESYTHRIGRTGRAGKEGIAVTFVNPIEMDYIRQIEDANG
                    ************************************************************

    COL             RKMSALRPPHRKEVLQAREDDIKEKVENWMSKESESRLKRISTELLNEYNDVDLVAALLQ
    N315            RKMSALRPPHRKEVLQAREDDIKEKVENWMSKESESRLKRISTELLNEYNDVDLVAALLQ
    NCTC8325        RKMSALRPPHRKEVLQAREDDIKEKVENWMSKESESRLKRISTELLNEYNDVDLVAALLQ
    Newman          RKMSALRPPHRKEVLQAREDDIKEKVENWMSKESESRLKRISTELLNEYNDVDLVAALLQ
    USA300_FPR3757  RKMSALRPPHRKEVLQAREDDIKEKVENWMSKESESRLKRISTELLNEYNDVDLVAALLQ
                    ************************************************************

    COL             ELVEANDEVEVQLTFEKPLSRKGRNGKPSGSRNRNSKRGNPKFDSKSKRSKGYSSKKKST
    N315            ELVEANDEVEVQLTFEKPLSRKGRNGKPSGSRNRNSKRGNPKFDSKSKRSKGYSSKKKST
    NCTC8325        ELVEANDEVEVQLTFEKPLSRKGRNGKPSGSRNRNSKRGNPKFDSKSKRSKGYSSKKKST
    Newman          ELVEANDEVEVQLTFEKPLSRKGRNGKPSGSRNRNSKRGNPKFDSKSKRSKGYSSKKKST
    USA300_FPR3757  ELVEANDEVEVQLTFEKPLSRKGRNGKPSGSRNRNSKRGNPKFDSKSKRSKGYSSKKKST
                    ************************************************************

    COL             KKFDRKEKSSGGSRPMKGRTFADHQK
    N315            KKFDRKEKSSGGSRPMKGRTFADHQK
    NCTC8325        KKFDRKEKSSGGSRPMKGRTFADHQK
    Newman          KKFDRKEKSSGGSRPMKGRTFADHQK
    USA300_FPR3757  KKFDRKEKSSGGSRPMKGRTFADHQK
                    **************************