From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005355000
  • symbol?: murF
  • description?: UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase

      descriptions from strain specific annotations:

    • UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase
    • UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate--D-alanyl-D-alanyl ligase
    • putativeUDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate--D-alanyl-D-alanyl ligase
    • UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6- diaminopimelate-D-alanyl-D-alanine ligase
    • putative UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase
    • UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase (UDP-MurNAc-pentapeptide synthetase) (D-alanyl-D-alanine-adding enzyme)
  • strand?: -
  • coordinates?: 5532201..5533728
  • synteny block?: BlockID0041520
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2073 (murF)
    N315:
    SA1886 (murF)
    NCTC8325:
    Newman:
    NWMN_1986 (murF)
    USA300_FPR3757:
    04-02981:
    SA2981_2023 (murF)
    08BA02176:
    C248_2093
    11819-97:
    MS7_2098 (murF)
    71193:
    ST398NM01_2123
    ECT-R 2:
    ECTR2_1938 (murF)
    ED133:
    SAOV_2123c
    ED98:
    SAAV_2136 (murF)
    HO 5096 0412:
    SAEMRSA15_19910
    JH1:
    SaurJH1_2157
    JH9:
    SaurJH9_2119
    JKD6008:
    SAA6008_02120 (murF)
    JKD6159:
    SAA6159_01996 (murF)
    LGA251:
    SARLGA251_18840
    M013:
    M013TW_2040
    MRSA252:
    SAR2169
    MSHR1132:
    SAMSHR1132_19060
    MSSA476:
    SAS1986
    Mu3:
    SAHV_2067 (murF)
    Mu50:
    SAV2082 (murF)
    MW2:
    MW2005 (murF)
    RF122:
    SAB1966c
    ST398:
    SAPIG2123
    T0131:
    SAT0131_02240 (spsB)
    TCH60:
    HMPREF0772_11113 (murF)
    TW20:
    SATW20_22210
    USA300_TCH1516:
    USA300HOU_2077 (murF)
    VC40:
    SAVC_09290

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MINVTLKQIQSWIPCEIEDQFLNQEINGVTIDSRAISKNMLFIPFKGENVDGHRFVSKAL
    N315            MINVTLKQIQSWIPCEIEDQFLNQEINGVTIDSRAISKNMLFIPFKGENVDGHRFVSKAL
    NCTC8325        MINVTLKQIQSWIPCEIEDQFLNQEINGVTIDSRAISKNMLFIPFKGENVDGHRFVSKAL
    Newman          MINVTLKQIQSWIPCEIEDQFLNQEINGVTIDSRAISKNMLFIPFKGENVDGHRFVSKAL
    USA300_FPR3757  MINVTLKQIQSWIPCEIEDQFLNQEINGVTIDSRAISKNMLFIPFKGENVDGHRFVSKAL
                    ************************************************************

    COL             QDGAGAAFYQRGTPIDENVSGPIIWVEDTLTALQQLAQAYLRHVNPKVIAVTGSNGKTTT
    N315            QDGAGAAFYQRGTPIDENVSGPIIWVEDTLTALQQLAQAYLRHVNPKVIAVTGSNGKTTT
    NCTC8325        QDGAGAAFYQRGTPIDENVSGPIIWVEDTLTALQQLAQAYLRHVNPKVIAVTGSNGKTTT
    Newman          QDGAGAAFYQRGTPIDENVSGPIIWVEDTLTALQQLAQAYLRHVNPKVIAVTGSNGKTTT
    USA300_FPR3757  QDGAGAAFYQRGTPIDENVSGPIIWVEDTLTALQQLAQAYLRHVNPKVIAVTGSNGKTTT
                    ************************************************************

    COL             KDMIESVLHTEFKVKKTQGNYNNEIGLPLTILELDNDTEISILEMGMSGFHEIEFLSNLA
    N315            KDMIESVLHTEFKVKKTQGNYNNEIGLPLTILELDNDTEISILEMGMSGFHEIEFLSNLA
    NCTC8325        KDMIESVLHTEFKVKKTQGNYNNEIGLPLTILELDNDTEISILEMGMSGFHEIEFLSNLA
    Newman          KDMIESVLHTEFKVKKTQGNYNNEIGLPLTILELDNDTEISILEMGMSGFHEIEFLSNLA
    USA300_FPR3757  KDMIESVLHTEFKVKKTQGNYNNEIGLPLTILELDNDTEISILEMGMSGFHEIEFLSNLA
                    ************************************************************

    COL             QPDIAVITNIGESHMQDLGSREGIAKAKSEITIGLKDNGTFIYDGDEPLLKPHVKEVENA
    N315            QPDIAVITNIGESHMQDLGSREGIAKAKSEITIGLKDNGTFIYDGDEPLLKPHVKEVENA
    NCTC8325        QPDIAVITNIGESHMQDLGSREGIAKAKSEITIGLKDNGTFIYDGDEPLLKPHVKEVENA
    Newman          QPDIAVITNIGESHMQDLGSREGIAKAKSEITIGLKDNGTFIYDGDEPLLKPHVKEVENA
    USA300_FPR3757  QPDIAVITNIGESHMQDLGSREGIAKAKSEITIGLKDNGTFIYDGDEPLLKPHVKEVENA
                    ************************************************************

    COL             KCISIGVATDNALVCSVDDRDTTGISFTINNKEHYDLPILGKHNMKNATIAIAVGHELGL
    N315            KCISIGVATDNALVCSVDDRDTTGISFTINNKEHYDLPILGKHNMKNATIAIAVGHELGL
    NCTC8325        KCISIGVATDNALVCSVDDRDTTGISFTINNKEHYDLPILGKHNMKNATIAIAVGHELGL
    Newman          KCISIGVATDNALVCSVDDRDTTGISFTINNKEHYDLPILGKHNMKNATIAIAVGHELGL
    USA300_FPR3757  KCISIGVATDNALVCSVDDRDTTGISFTINNKEHYDLPILGKHNMKNATIAIAVGHELGL
                    ************************************************************

    COL             TYNTIYQNLKNVSLTGMRMEQHTLENDITVINDAYNASPTSMRAAIDTLSTLTGRRILIL
    N315            TYNTIYQNLKNVSLTGMRMEQHTLENDITVINDAYNASPTSMRAAIDTLGTLTGRRILIL
    NCTC8325        TYNTIYQNLKNVSLTGMRMEQHTLENDITVINDAYNASPTSMRAAIDTLSTLTGRRILIL
    Newman          TYNTIYQNLKNVSLTGMRMEQHTLENDITVINDAYNASPTSMRAAIDTLSTLTGRRILIL
    USA300_FPR3757  IYNTIYQNLKNVSLTGMRMEQHTLENDITVINDAYNASPTSMRAAIDTLSTLTGRRILIL
                     ************************************************.**********

    COL             GDVLELGENSKEMHIGVGNYLEEKHIDVLYTFGNEAKYIYDSGQQHVEKAQHFNSKDDMI
    N315            GDVLELGENSKEMHIGVGNYLEEKHIDVLYTFGNEAKYIYDSGQQHVEKAQHFNSKDDMI
    NCTC8325        GDVLELGENSKEMHIGVGNYLEEKHIDVLYTFGNEAKYIYDSGQQHVEKAQHFNSKDDMI
    Newman          GDVLELGENSKEMHIGVGNYLEEKHIDVLYTFGNEAKYIYDSGQQHVEKAQHFNSKDDMI
    USA300_FPR3757  GDVLELGENSKEMHIGVGNYLEEKHIDVLYTFGNEAKYIYDSGQQHVEKAQHFNSKDDMI
                    ************************************************************

    COL             EVLINDLKAHDRVLVKGSRGMKLEEVVNALIS
    N315            EVLTSDLKAHDRVLVKGSRGMKLEEVVNALIS
    NCTC8325        EVLINDLKAHDRVLVKGSRGMKLEEVVNALIS
    Newman          EVLINDLKAHDRVLVKGSRGMKLEEVVNALIS
    USA300_FPR3757  EVLINDLKAHDRVLVKGSRGMKLEEVVNALIS
                    *** .***************************