From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005361000
  • symbol?:
  • description?: hypothetical protein
  • strand?: -
  • coordinates?: 5537806..5537943
  • synteny block?: BlockID0041580
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2026
    08BA02176:
    C248_2096
    11819-97:
    MS7_2101
    71193:
    ST398NM01_2126
    ECT-R 2:
    ECTR2_1941
    ED133:
    SAOV_2126c
    ED98:
    SAAV_2139
    HO 5096 0412:
    SAEMRSA15_19940
    JH1:
    SaurJH1_2160
    JH9:
    SaurJH9_2122
    JKD6008:
    SAA6008_02123
    JKD6159:
    SAA6159_01999
    LGA251:
    SARLGA251_18870
    M013:
    M013TW_2043
    MRSA252:
    SAR2173
    MSHR1132:
    SAMSHR1132_19090
    MSSA476:
    SAS1989
    Mu3:
    SAHV_2070
    Mu50:
    SAV2085
    MW2:
    MW2008
    RF122:
    SAB1969c
    ST398:
    SAPIG2126
    T0131:
    SAT0131_02243 (rexA)
    TCH60:
    HMPREF0772_11108
    TW20:
    SATW20_22240
    USA300_TCH1516:
    USA300HOU_2080
    VC40:
    SAVC_09305

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKRPEKIQNVVKLLSSLGVNIKKTKSRLDIINTLPASNKVSHELK
    N315            MKRPEKIQNVVKLLSSLGVNIKKTKSRLDIINTLPASNKVSHELK
    NCTC8325        MKRPEKIQNVVKLLSSLGVNIKKTKSRLDIINTLPASNKVSHELK
    Newman          MKRPEKIQNVVKLLSSLGVNIKKTKSRLDIINTLPASNKVSHELK
    USA300_FPR3757  MKRPEKIQNVVKLLSSLGVNIKKTKSRLDIINTLPASNKVSHELK
                    *********************************************