From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1989 [new locus tag: NWMN_RS11505 ]
  • pan locus tag?: SAUPAN005361000
  • symbol: NWMN_1989
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_1989 [new locus tag: NWMN_RS11505 ]
  • symbol: NWMN_1989
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2212090..2212227
  • length: 138
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    ATGAAACGTCCTGAAAAGATTCAAAATGTAGTCAAACTATTGTCATCATTAGGTGTGAAT
    ATTAAAAAAACTAAATCTCGTTTAGACATTATTAATACTTTGCCAGCATCTAATAAAGTA
    AGTCACGAATTAAAATAA
    60
    120
    138

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_1989 [new locus tag: NWMN_RS11505 ]
  • symbol: NWMN_1989
  • description: hypothetical protein
  • length: 45
  • theoretical pI: 11.2476
  • theoretical MW: 5070.04
  • GRAVY: -0.424444

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:  
    Hypothetical protein SAV2085 
  • PFAM:
    GAG-polyprotein (CL0523) Retrotran_gag_2; gag-polypeptide of LTR copia-type (PF14223; HMM-score: 14.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.193
    • Ymax_pos: 11
    • Cmax: 0.109
    • Cmax_pos: 28
    • Smax: 0.501
    • Smax_pos: 2
    • Smean: 0.375
    • D: 0.264
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKRPEKIQNVVKLLSSLGVNIKKTKSRLDIINTLPASNKVSHELK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor: SigB [1] other strains
    SigB (sigma factor) controls a large regulon involved in stress/starvation response and adaptation
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
    Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
    J. Bacteriol.: 2004, 186(13);4085-99
    [PubMed:15205410] [WorldCat.org] [DOI] (P p)

Relevant publications[edit source | edit]