From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005363000
  • symbol?:
  • description?: Protein of hypothetical function

      descriptions from strain specific annotations:

    • Protein of hypothetical function
    • copper-sensing transcriptional repressor CsoR
    • pseudogene
  • strand?: -
  • coordinates?: 5538293..5538586
  • synteny block?: BlockID0041600
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2028
    08BA02176:
    C248_2098
    11819-97:
    MS7_2103 (csoR)
    71193:
    ST398NM01_2128
    ECT-R 2:
    ECTR2_1943
    ED133:
    SAOV_2128c
    ED98:
    SAAV_2141
    HO 5096 0412:
    SAEMRSA15_19960
    JH1:
    SaurJH1_2162
    JH9:
    SaurJH9_2124
    JKD6008:
    SAA6008_02125
    JKD6159:
    SAA6159_02001
    LGA251:
    SARLGA251_18890
    M013:
    M013TW_2045
    MRSA252:
    SAR2175
    MSHR1132:
    SAMSHR1132_19110
    MSSA476:
    SAS1991
    Mu3:
    SAHV_2072
    Mu50:
    SAV2087
    MW2:
    MW2010
    RF122:
    SAB1971c
    ST398:
    SAPIG2128
    T0131:
    SAT0131_02245
    TCH60:
    HMPREF0772_11106
    TW20:
    SATW20_22260
    USA300_TCH1516:
    USA300HOU_2082
    VC40:
    SAVC_09315

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ---------------MTEQDNAHHSEQIKTNLKSRLNRIEGQVRAINRMIEEDVYCDDVL
    N315            ---------------MTEQDNAHHSEQIKTNLKSRLNRIEGQVRAINRMIEEDVYCDDVL
    NCTC8325        ---------------MTEQDNAHHSEQIKTNLKSRLNRIEGQVRAINRMIEEDVYCDDVL
    Newman          MGYSIVRNVNEGVNAMTEQDNAHHSEQIKTNLKSRLNRIEGQVRAINRMIEEDVYCDDVL
    USA300_FPR3757  ---------------MTEQDNAHHSEQIKTNLKSRLNRIEGQVRAINRMIEEDVYCDDVL
                                   *********************************************

    COL             TQIRATRSALNSVAIKLLEQHMKSCIMNKVNQGAQEEAMEELLVTFQKLIKD
    N315            TQIRATRSALNSVAIKLLEQHMKSCIMNKVNQGAQEEAMEELLVTFQKLIKD
    NCTC8325        TQIRATRSALNSVAIKLLEQHMKSCIMNKVNQGAQEEAMEELLVTFQKLIKD
    Newman          TQIRATRSALNSVAIKLLEQHMKSCIMNKVNQGAQEEAMEELLVTFQKLIKD
    USA300_FPR3757  TQIRATRSALNSVAIKLLEQHMKSCIMNKVNQGAQEEAMEELLVTFQKLIKD
                    ****************************************************