From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005371000
  • symbol?: yidC
  • description?: protein translocase component YidC

      descriptions from strain specific annotations:

    • protein translocase component YidC
    • lipoprotein
    • membrane protein oxaA precursor
    • membrane protein oxaA
    • 60 kDa inner membrane insertion protein
    • 60 kDa inner membrane protein YIDC
    • 60Kd inner membrane family protein
    • Inner membrane protein translocase component YidC
    • lipoprotein precursor
    • membrane-embedded lipoprotein precursor
    • OxaI/YidC membrane insertion protein
  • strand?: -
  • coordinates?: 5543450..5544058
  • synteny block?: BlockID0041680
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_1994 (oxaA)
    USA300_FPR3757:
    04-02981:
    SA2981_2031 (oxaI)
    08BA02176:
    C248_2103
    11819-97:
    MS7_2106 (oxaA)
    71193:
    ST398NM01_2133
    ECT-R 2:
    ECTR2_1946
    ED133:
    SAOV_2131c
    ED98:
    SAAV_2144
    HO 5096 0412:
    SAEMRSA15_19990
    JH1:
    SaurJH1_2165
    JH9:
    SaurJH9_2127
    JKD6008:
    SAA6008_02128 (oxaI)
    JKD6159:
    SAA6159_02004 (oxaI)
    LGA251:
    SARLGA251_18920
    M013:
    M013TW_2048
    MRSA252:
    SAR2179
    MSHR1132:
    SAMSHR1132_19140
    MSSA476:
    SAS1994
    Mu3:
    SAHV_2075
    Mu50:
    SAV2090
    MW2:
    MW2013
    RF122:
    SAB1974c
    ST398:
    SAPIG2133
    T0131:
    SAT0131_02249 (cdr)
    TCH60:
    HMPREF0772_11102
    TW20:
    SATW20_22290
    USA300_TCH1516:
    USA300HOU_2087
    VC40:
    SAVC_09330

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKKKALLPLFLGIMVFLAGCDYSKPEKRSGFFYNTFVDPMKNVLDWLGNNLLNDNYGLAI
    N315            MKKKALLPLFLGIMVFLAGCDYSKPEKRSGFFYNTFVDPMKNVLDWLGNNLLNDNYGLAI
    NCTC8325        MKKKALLPLFLGIMVFLAGCDYSKPEKRSGFFYNTFVDPMKNVLDWLGNNLLNDNYGLAI
    Newman          MKKKALLPLFLGIMVFLAGCDYSKPEKRSGFFYNTFVDPMKNVLDWLGNNLLNDNYGLAI
    USA300_FPR3757  MKKKALLPLFLGIMVFLAGCDYSKPEKRSGFFYNTFVDPMKNVLDWLGNNLLNDNYGLAI
                    ************************************************************

    COL             IILVLVIRIILLPFMLSNYKNSHMMRQKMKVAKPEVEKIQEKVKRARTQEEKMAANQELM
    N315            IILVLVIRIILLPFMLSNYKNSHMMRQKMKVAKPEVEKIQEKVKRARTQEEKMAANQELM
    NCTC8325        IILVLVIRIILLPFMLSNYKNSHMMRQKMKVAKPEVEKIQEKVKRARTQEEKMAANQELM
    Newman          IILVLVIRIILLPFMLSNYKNSHMMRQKMKVAKPEVEKIQEKVKRARTQEEKMAANQELM
    USA300_FPR3757  IILVLVIRIILLPFMLSNYKNSHMMRQKMKVAKPEVEKIQEKVKRARTQEEKMAANQELM
                    ************************************************************

    COL             QVYKKYDMNPIKSMLGCLPMLIQLPIIMGLYFVLKDQLVDGLFKYPHFLWFDLGRPDIWI
    N315            QVYKKYDMNPIKSMLGCLPMLIQLPIIMGLYFVLKDQLVDGLFKYPHFLWFDLGRPDIWI
    NCTC8325        QVYKKYDMNPIKSMLGCLPMLIQLPIIMGLYFVLKDQLVDGLFKYPHFLWFDLGRPDIWI
    Newman          QVYKKYDMNPIKSMLGCLPMLIQLPIIMGLYFVLKDQLVDGLFKYPHFLWFDLGRPDIWI
    USA300_FPR3757  QVYKKYDMNPIKSMLGCLPMLIQLPIIMGLYFVLKDQLVDGLFKYPHFLWFDLGRPDIWI
                    ************************************************************

    COL             TIIAGVLYFIQAYVSSKTMPDEQRQMGYMMMVISPIMIIWISLSSASALGLYWSVSAAFL
    N315            TIIAGVLYFIQAYVSSKTMPDEQRQMGYMMMVISPIMIIWISLSSASALGLYWSVSAAFL
    NCTC8325        TIIAGVLYFIQAYVSSKTMPDEQRQMGYMMMVISPIMIIWISLSSASALGLYWSVSAAFL
    Newman          TIIAGVLYFIQAYVSSKTMPDEQRQMGYMMMVISPIMIIWISLSSASALGLYWSVSAAFL
    USA300_FPR3757  TIIAGVLYFIQAYVSSKTMPDEQRQMGYMMMVISPIMIIWISLSSASALGLYWSVSAAFL
                    ************************************************************

    COL             VVQTHFANIYYEKVAKKEVQPFIEAYEREHNGGSNKKGKNTQVVSKKKKK
    N315            VVQTHFANIYYEKVAKKEVQPFIEAYEREHNGGSNKKGKNTQVVSKKKKK
    NCTC8325        VVQTHFANIYYEKVAKKEVQPFIEAYEREHNGGSNKKGKNTQVVSKKKKK
    Newman          VVQTHFANIYYEKVAKKEVQPFIEAYEREHNGGSNKKGKNTQVVSKKKKK
    USA300_FPR3757  VVQTHFANIYYEKVAKKEVQPFIEAYEREHNGGSNKKGKNTQVVSKKKKK
                    **************************************************