From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005375000
  • symbol?: thiD
  • description?: phosphomethylpyrimidine kinase

      descriptions from strain specific annotations:

    • phosphomethylpyrimidine kinase
    • bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase
    • bifunctional hydroxy-methylpyrimidine kinase/ hydroxy-phosphomethylpyrimidine kinase
    • hydroxymethylpyrimidine/phosphomethylpyrimidine kinase
    • hydroxymethylpyrimidine kinase
    • phosphomethylpyrimidine kinase (HMP-phosphate kinase)(HMP-P kinase)
    • pseudogene
    • putative phosphomethylpyrimidine kinase
  • strand?: -
  • coordinates?: 5545829..5546659
  • synteny block?: BlockID0041720
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2085 (thiD2)
    N315:
    SA1896 (thiD)
    NCTC8325:
    Newman:
    NWMN_1997 (thiD)
    USA300_FPR3757:
    04-02981:
    SA2981_2034 (thiD)
    08BA02176:
    C248_2106 (thiD)
    11819-97:
    MS7_2109 (thiD)
    71193:
    ST398NM01_2136
    ECT-R 2:
    ECTR2_1949 (thiD)
    ED133:
    SAOV_2134c (thiD2)
    ED98:
    SAAV_2147 (thiD2)
    HO 5096 0412:
    SAEMRSA15_20020 (thiD)
    JH1:
    SaurJH1_2168
    JH9:
    SaurJH9_2130
    JKD6008:
    SAA6008_02131 (thiD)
    JKD6159:
    SAA6159_02007 (thiD)
    LGA251:
    SARLGA251_18950 (thiD)
    M013:
    M013TW_2051
    MRSA252:
    SAR2182 (thiD)
    MSHR1132:
    SAMSHR1132_19170
    MSSA476:
    SAS1997
    Mu3:
    SAHV_2078 (thiD)
    Mu50:
    SAV2093 (thiD)
    MW2:
    MW2016 (thiD)
    RF122:
    SAB1977c (thiD)
    ST398:
    SAPIG2136 (thiD)
    T0131:
    SAT0131_02253 (clpB)
    TCH60:
    HMPREF0772_11098 (thiD)
    TW20:
    SATW20_22320 (thiD)
    USA300_TCH1516:
    VC40:
    SAVC_09345

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIKPKIALTIAGTDPTGGAGVMADLKSFHSCGVYGMGVVTSIVAQNTLGVQHIHNLNHQW
    N315            MIKPKIALTIAGTDPTGGAGVMADLKSFHSCGVYGMGVVTSIVAQNTLGVQHIHNLNHQW
    NCTC8325        MIKPKIALTIAGTDPTGGAGVMADLKSFHSCGVYGMGVVTSIVAQNTLGVQHIHNLNHQW
    Newman          MIKPKIALTIAGTDPTGGAGVMADLKSFHSCGVYGMGVVTSIVAQNTLGVQHIHNLNHQW
    USA300_FPR3757  MIKPKIALTIAGTDPTGGAGVMADLKSFHSCGVYGMGVVTSIVAQNTLGVQHIHNLNHQW
                    ************************************************************

    COL             VDEQLDSVFNDTLPHAIKTGMIATADTMETIRHYLMQHESIPYVIDPVMLAKSGDSLMDN
    N315            VDEQLDSVFNDTLPHAIKTGMIATADTMETIRHYLMQHESIPYVIDPVMLAKSGDSLMDN
    NCTC8325        VDEQLDSVFNDTLPHAIKTGMIATADTMETIRHYLMQHESIPYVIDPVMLAKSGDSLMDN
    Newman          VDEQLDSVFNDTLPHAIKTGMIATADTMETIRHYLMQHESIPYVIDPVMLAKSGDSLMDN
    USA300_FPR3757  VDEQLDSVFNDTLPHAIKTGMIATADTMETIRHYLMQHESIPYVIDPVMLAKSGDSLMDN
                    ************************************************************

    COL             DTKQNLQHTLLPLADVVTPNLPEAEEITGLTIDSEEKIMQAGRIFINEIGSKGVIIKGGH
    N315            DTKQNLQHTLLPLADVVTPNLPEAEEITGLTIDSEEKIMQAGRIFINEIGSKGIIIKGGH
    NCTC8325        DTKQNLQHTLLPLADVVTPNLPEAEEITGLTIDSEEKIMQAGRIFINEIGSKGVIIKGGH
    Newman          DTKQNLQHTLLPLADVVTPNLPEAEEITGLTIDSEEKIMQAGRIFINEIGSKGVIIKGGH
    USA300_FPR3757  DTKQNLQHTLLPLADVVTPNLPEAEEITGLTIDSEEKIMQAGRIFINEIGSKGVIIKGGH
                    *****************************************************:******

    COL             SNDTDIAKDYLFTNEGVQTFENERFKTKHTHGTGCTFSAVITAELAKGRPLFEAVHKAKK
    N315            SNDTDIAKDYLFTNEGVQTFENERFKTKHTHGTGCTFSAVITAELAKGRPLFEAVHKAKK
    NCTC8325        SNDTDIAKDYLFTNEGVQTFENERFKTKHTHGTGCTFSAVITAELAKGRPLFEAVHKAKK
    Newman          SNDTDIAKDYLFTNEGVQTFENERFKTKHTHGTGCTFSAVITAELAKGRPLFEAVHKAKK
    USA300_FPR3757  SNDTDIAKDYLFTNEGVQTFENERFKTKHTHGTGCTFSAVITAELAKGRPLFEAVHKAKK
                    ************************************************************

    COL             FISMSIQYTPEIGRGRGPVNHFAYLKKEGLDDELSK
    N315            FISMSIQYTPEIGRGRGPVNHFAYLKKEGLDDELSK
    NCTC8325        FISMSIQYTPEIGRGRGPVNHFAYLKKEGLDDELSK
    Newman          FISMSIQYTPEIGRGRGPVNHFAYLKKEGLDDELSK
    USA300_FPR3757  FISMSIQYTPEIGRGRGPVNHFAYLKKEGLDDELSK
                    ************************************