From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005407000
  • symbol?:
  • description?: Sua5/YciO/YrdC/YwlC family protein

      descriptions from strain specific annotations:

    • Sua5/YciO/YrdC/YwlC family protein
    • Sua5 YciO YrdC YwlC family protein
    • SUA5 domain protein
    • yrdC/SUA5 multi-domain translation factor protein
    • YrdC/Sua5 family protein
  • strand?: -
  • coordinates?: 5566847..5567893
  • synteny block?: BlockID0042030
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2056
    08BA02176:
    C248_2130
    11819-97:
    MS7_2132
    71193:
    ST398NM01_2158
    ECT-R 2:
    ECTR2_1972
    ED133:
    SAOV_2157c
    ED98:
    SAAV_2171
    HO 5096 0412:
    SAEMRSA15_20240
    JH1:
    SaurJH1_2190
    JH9:
    SaurJH9_2152
    JKD6008:
    SAA6008_02154 (sua5)
    JKD6159:
    SAA6159_02030 (sua5)
    LGA251:
    SARLGA251_19170
    M013:
    M013TW_2075
    MRSA252:
    SAR2204
    MSHR1132:
    SAMSHR1132_19390
    MSSA476:
    SAS2019
    Mu3:
    SAHV_2100
    Mu50:
    SAV2116
    MW2:
    MW2040
    RF122:
    SAB2000c
    ST398:
    SAPIG2158
    T0131:
    SAT0131_02279
    TCH60:
    HMPREF0772_11075
    TW20:
    SATW20_22540
    USA300_TCH1516:
    VC40:
    SAVC_09455

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             --------------MIKLDTKIWDVREYNEDLQQYPKINEIKDIVLNGGLIGLPTETVYG
    N315            -----------------MDTKIWDVREYNEDLQQYPKINEIKDIVLNGGLIGLPTETVYG
    NCTC8325        MHSFLLYIMINKKGVIKLDTKIWDVREYNEDLQQYPKINEIKDIVLNGGLIGLPTETVYG
    Newman          -----------------MDTKIWDVREYNEDLQQYPKINEIKDIVLNGGLIGLPTETVYG
    USA300_FPR3757  -----------------MDTKIWDVREYNEDLQQYPKINEIKDIVLNGGLIGLPTETVYG
                                     :******************************************

    COL             LAANATDEEAVAKIYEAKGRPSDNPLIVHIHSKGQLKDFTYTLDPRVEKLMQAFWPGPIS
    N315            LAANATDEEAVAKIYEAKGRPSDNPLIVHIHSKVQLKDFTYTLDPRVEKLMQAFWPGPIS
    NCTC8325        LAANATDEEAVAKIYEAKGRPSDNPLIVHIHSKGQLKDFTYTLDPRVEKLMQAFWPGPIS
    Newman          LAANATDEEAVAKIYEAKGRPSDNPLIVHIHSKGQLKDFTYTLDPRVEKLMQAFWPGPIS
    USA300_FPR3757  LAANATDEEAVAKIYEAKGRPSDNPLIVHIHSKGQLKDFTYTLDPRVEKLMQAFWPGPIS
                    ********************************* **************************

    COL             FILPLKLGYLCRKVSGGLSSVAVRMPSHSVGRQLLQIINEPLAAPSANLSGRPSPTTFNH
    N315            FILPLKPGYLCRKVSGGLSSVAVRMPSHSVGRQLLQIINEPLAAPSANLSGRPSPTTFNH
    NCTC8325        FILPLKLGYLCRKVSGGLSSVAVRMPSHSVGRQLLQIINEPLAAPSANLSGRPSPTTFNH
    Newman          FILPLKLGYLCRKVSGGLSSVAVRMPSHSVGRQLLQIINEPLAAPSANLSGRPSPTTFNH
    USA300_FPR3757  FILPLKLGYLCRKVSGGLSSVAVRMPSHSVGRQLLQIINEPLAAPSANLSGRPSPTTFNH
                    ****** *****************************************************

    COL             VYQDLNGRIDGIVQAEQSEEGLESTVLDCTSFPYKIARPGSITAAMITEILPNSIAHADY
    N315            VYQDLNARIDGIVQAEQSEEGLESTVLDCTSFPYKIARPGSITAAMITEILPNSIAHADY
    NCTC8325        VYQDLNGRIDGIVQAEQSEEGLESTVLDCTSFPYKIARPGSITAAMITEILPNSIAHADY
    Newman          VYQDLNGRIDGIVQAEQSEEGLESTVLDCTSFPYKIARPGSITAAMITEILPNSIAHADY
    USA300_FPR3757  VYQDLNGRIDGIVQAEQSEEGLESTVLDCTSFPYKIARPGSITAAMITEILPNSIAHADY
                    ******.*****************************************************

    COL             NDTEQPIAPGMKYKHYSPNTPLTIITDIESKIGNDGKDWSSIAFIVPSNKVAFIPSEAQF
    N315            NDTEQPIAPGMKYKHYSPNTPLTIITDIESKIGNDGKDWSSIAFIVPSNKVAFIPSEAQF
    NCTC8325        NDTEQPIAPGMKYKHYSPNTPLTIITDIESKIGNDGKDWSSIAFIVPSNKVAFIPSEAQF
    Newman          NDTEQPIAPGMKYKHYSPNTPLTIITDIESKIGNDGKDWSSIAFIVPSNKVAFIPSEAQF
    USA300_FPR3757  NDTEQPIAPGMKYKHYSPNTPLTIITDIESKIGNDGKDWSSIAFIVPSNKVAFIPSEAQF
                    ************************************************************

    COL             IQLCQDDNDVKQASHNLYDVLHSLDENENISAAYIYGFELNDNTEAIMNRMLKAAGNHII
    N315            IQLCQDDNDVKQASHNLYDVLHSLDENENISAAYIYGFELNDNTEAIMNRMLKAAGNHII
    NCTC8325        IQLCQDDNDVKQASHNLYDVLHSLDENENISAAYIYGFELNDNTEAIMNRMLKAAGNHII
    Newman          IQLCQDDNDVKQASHNLYDVLHSLDENENISAAYIYGFELNDNTEAIMNRMLKAAGNHII
    USA300_FPR3757  IQLCQDDNDVKQASHNLYDVLHSLDENENISAAYIYGFELNDNTEAIMNRMLKAAGNHII
                    ************************************************************

    COL             KGCEL
    N315            KGCEL
    NCTC8325        KGCEL
    Newman          KGCEL
    USA300_FPR3757  KGCEL
                    *****