From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005410000
  • symbol?: tdk
  • description?: thymidine kinase

      descriptions from strain specific annotations:

    • thymidine kinase
    • putative thymidine kinase
  • strand?: -
  • coordinates?: 5569877..5570476
  • synteny block?: BlockID0042060
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2111 (tdk)
    N315:
    SA1921 (tdk)
    NCTC8325:
    Newman:
    NWMN_2023 (tdk)
    USA300_FPR3757:
    04-02981:
    SA2981_2059 (tdk)
    08BA02176:
    C248_2133
    11819-97:
    MS7_2135 (tdk)
    71193:
    ST398NM01_2161
    ECT-R 2:
    ECTR2_1975
    ED133:
    SAOV_2160c
    ED98:
    SAAV_2174 (tdk)
    HO 5096 0412:
    SAEMRSA15_20270
    JH1:
    SaurJH1_2193
    JH9:
    SaurJH9_2155
    JKD6008:
    SAA6008_02157 (tdk)
    JKD6159:
    SAA6159_02033 (tdk)
    LGA251:
    SARLGA251_19200
    M013:
    M013TW_2078
    MRSA252:
    SAR2207
    MSHR1132:
    SAMSHR1132_19420
    MSSA476:
    SAS2022
    Mu3:
    SAHV_2103 (tdk)
    Mu50:
    SAV2119 (tdk)
    MW2:
    MW2043 (tdk)
    RF122:
    SAB2003c
    ST398:
    SAPIG2161 (tdk)
    T0131:
    SAT0131_02282 (spxA)
    TCH60:
    HMPREF0772_11072 (tdk)
    TW20:
    SATW20_22570
    USA300_TCH1516:
    USA300HOU_2107 (tdk)
    VC40:
    SAVC_09470

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MYETYHSGWIECITGSMFSGKSEELIRRLRRGIYAKQKVVVFKPAIDDRYHKEKVVSHNG
    N315            MYETYHSGWIECITGSMFSGKSEELIRRLRRGIYAKQKVVVFKPAIDDRYHKEKVVSHNG
    NCTC8325        MYETYHSGWIECITGSMFSGKSEELIRRLRRGIYAKQKVVVFKPAIDDRYHKEKVVSHNG
    Newman          MYETYHSGWIECITGSMFSGKSEELIRRLRRGIYAKQKVVVFKPAIDDRYHKEKVVSHNG
    USA300_FPR3757  MYETYHSGWIECITGSMFSGKSEELIRRLRRGIYAKQKVVVFKPAIDDRYHKEKVVSHNG
                    ************************************************************

    COL             NAIEAINISKASEIMTHDLTNVDVIGIDEVQFFDDEIVSIVEKLSADGHRVIVAGLDMDF
    N315            NAIEAINISKASEIMTHNLTNVDVIGIDEVQFFDDEIVSIVEKLSADGHRVIVAGLDMDF
    NCTC8325        NAIEAINISKASEIMTHDLTNVDVIGIDEVQFFDDEIVSIVEKLSADGHRVIVAGLDMDF
    Newman          NAIEAINISKASEIMTHDLTNVDVIGIDEVQFFDDEIVSIVEKLSADGHRVIVAGLDMDF
    USA300_FPR3757  NAIEAINISKASEIMTHDLTNVDVIGIDEVQFFDDEIVSIVEKLSADGHRVIVAGLDMDF
                    *****************:******************************************

    COL             RGEPFEPMPKLMAVSEQVTKLQAVCAVCGSSSSRTQRLINGKPAKIDDPIILVGANESYE
    N315            RGEPFEPMPKLMAVSEQVTKLQAVCAVCGSSSSRTQRLINGKPAKIDDPIILVGANESYE
    NCTC8325        RGEPFEPMPKLMAVSEQVTKLQAVCAVCGSSSSRTQRLINGKPAKIDDPIILVGANESYE
    Newman          RGEPFEPMPKLMAVSEQVTKLQAVCAVCGSSSSRTQRLINGKPAKIDDPIILVGANESYE
    USA300_FPR3757  RGEPFEPMPKLMAVSEQVTKLQAVCAVCGSSSSRTQRLINGKPAKIDDPIILVGANESYE
                    ************************************************************

    COL             PRCRAHHIVAPSDNNKEEL
    N315            PRCRAHHIVAPSDNNKEEL
    NCTC8325        PRCRAHHIVAPSDNNKEEL
    Newman          PRCRAHHIVAPSDNNKEEL
    USA300_FPR3757  PRCRAHHIVAPSDNNKEEL
                    *******************