From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005424000
  • symbol?:
  • description?: N-acetyltransferase

      descriptions from strain specific annotations:

    • N-acetyltransferase
    • acetyltransferase
    • acetyltransferase, GNAT family protein
    • acetyltransferase (GNAT) family protein
    • acetyltransferase, gnat family
    • acetyltransferase family protein
    • GNAT family acetyltransferase
    • N-acetyltransferase GCN5
    • putative acetyltransferase
    • spermine/spermidine acetyltransferase blt
  • strand?: -
  • coordinates?: 5583155..5584015
  • synteny block?: BlockID0042190
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2069 (blt)
    08BA02176:
    C248_2143
    11819-97:
    MS7_2147
    71193:
    ST398NM01_2171
    ECT-R 2:
    ECTR2_1985
    ED133:
    SAOV_2170c
    ED98:
    SAAV_2184
    HO 5096 0412:
    SAEMRSA15_20370
    JH1:
    SaurJH1_2203
    JH9:
    SaurJH9_2165
    JKD6008:
    SAA6008_02167
    JKD6159:
    SAA6159_02043
    LGA251:
    SARLGA251_19300
    M013:
    M013TW_2088
    MRSA252:
    SAR2217
    MSHR1132:
    SAMSHR1132_19520
    MSSA476:
    SAS2032
    Mu3:
    SAHV_2113
    Mu50:
    SAV2129
    MW2:
    MW2053
    RF122:
    SAB2013c
    ST398:
    SAPIG2171
    T0131:
    SAT0131_02293
    TCH60:
    HMPREF0772_11061
    TW20:
    SATW20_22670
    USA300_TCH1516:
    USA300HOU_2118
    VC40:
    SAVC_09520

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAKELCFEGITLKAFDEQYRSAINDFDLNERQQIYSSLPKEVIDDAINDADRIANVAIND
    N315            MAKELCFEGITLKAFDEQYRSAINDFDLNERQQIYSSLPKEVIDDAINDVDRIANVAIND
    NCTC8325        MAKELCFEGITLKAFDEQYRSAINDFDLNERQQIYSSLPKEVIDDAINDADRIANVAIND
    Newman          MAKELCFEGITLKAFDEQYRSAINDFDLNERQQIYSSLPKEVIDDAINDADRIANVAIND
    USA300_FPR3757  MAKELCFEGITLKAFDEQYRSAINDFDLNERQQIYSSLPKEVIDDAINDADRIANVAIND
                    *************************************************.**********

    COL             KNEVVGFFVLHRYYQHEGYDTPENVVYIRSLSINEKYQGFGYGTKIMMSLPQYVQGVFPD
    N315            KNEVVGFFVLHRYYQHEGYDTPENVVYIRSLSINEKYQGFGYGTKIMMSLPQYVQGVFPD
    NCTC8325        KNEVVGFFVLHRYYQHEGYDTPENVVYIRSLSINEKYQGFGYGTKIMMSLPQYVQGVFPD
    Newman          KNEVVGFFVLHRYYQHEGYDTPENVVYIRSLSINEKYQGFGYGTKIMMSLPQYVQGVFPD
    USA300_FPR3757  KNEVVGFFVLHRYYQHEGYDTPENVVYIRSLSINEKYQGFGYGTKIMMSLPQYVQGVFPD
                    ************************************************************

    COL             FNHLYLVVDAENDNAWNLYERAGFMHTATKEEGPIGKERLYYLDLDSKHVSSLKLEEESR
    N315            FNHLYLVVDAENDNAWNLYERAGFMHTATKEEGPIGKERLYYLDLDSKHVSSLKLEEESR
    NCTC8325        FNHLYLVVDAENDNAWNLYERAGFMHTATKEEGPIGKERLYYLDLDSKHVSSLKLEEESR
    Newman          FNHLYLVVDAENDNAWNLYERAGFMHTATKEEGPIGKERLYYLDLDSKHVSSLKLEEESR
    USA300_FPR3757  FNHLYLVVDAENDNAWNLYERAGFMHTATKEEGPIGKERLYYLDLDSKHVSSLKLEEESR
                    ************************************************************

    COL             SEVTNVHIINLMIDGQKVGFIALEQIGERMNIAAIEVDKSYRFNGIGSSALRQLPTYLRK
    N315            SEVTNVHIINLMIDGQKVGFIALEQIGERMNIAAIEVDKSYRFNGIGSSALRQLPTYLRK
    NCTC8325        SEVTNVHIINLMIDGQKVGFIALEQIGERMNIAAIEVDKSYRFNGIGSSALRQLPTYLRK
    Newman          SEVTNVHIINLMIDGQKVGFIALEQIGERMNIAAIEVDKSYRFNGIGSSALRQLPTYLRK
    USA300_FPR3757  SEVTNVHIINLMIDGQKVGFIALEQIGERMNIAAIEVDKSYRFNGIGSSALRQLPTYLRK
                    ************************************************************

    COL             NYDNLNVITMILFGENNDFKPLCLNSNFVEIEQTDDYVVFEKYLNY
    N315            NYDNLNVITMILFGENNDFKPLCLNSNFVEIEQTDDYVVFEKYLNY
    NCTC8325        NYDNLNVITMILFGENNDFKPLCLNSNFVEIEQTDDYVVFEKYLNY
    Newman          NYDNLNVITMILFGENNDFKPLCLNSNFVEIEQTDDYVVFEKYLNY
    USA300_FPR3757  NYDNLNVITMILFGENNDFKPLCLNSNFVEIEQTDDYVVFEKYLNY
                    **********************************************