From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005426000
  • symbol?: coaA
  • description?: pantothenate kinase

      descriptions from strain specific annotations:

    • pantothenate kinase
    • type II pantothenate kinase
    • Pantothenate kinase type II, eukaryotic
  • strand?: +
  • coordinates?: 5584535..5585338
  • synteny block?: BlockID0042210
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2070
    08BA02176:
    C248_2145
    11819-97:
    MS7_2148 (coaA)
    71193:
    ST398NM01_2172
    ECT-R 2:
    ECTR2_1986 (coaA)
    ED133:
    SAOV_2171
    ED98:
    SAAV_2185
    HO 5096 0412:
    SAEMRSA15_20380
    JH1:
    SaurJH1_2204
    JH9:
    SaurJH9_2166
    JKD6008:
    SAA6008_02168 (panK)
    JKD6159:
    SAA6159_02044 (panK)
    LGA251:
    SARLGA251_19310 (coaW)
    M013:
    M013TW_2089
    MRSA252:
    SAR2218
    MSHR1132:
    SAMSHR1132_19530
    MSSA476:
    SAS2033
    Mu3:
    SAHV_2114
    Mu50:
    SAV2130
    MW2:
    MW2054
    RF122:
    SAB2014
    ST398:
    SAPIG2172 (coaA)
    T0131:
    SAT0131_02294
    TCH60:
    HMPREF0772_11060 (coaA)
    TW20:
    SATW20_22680 (coaW)
    USA300_TCH1516:
    USA300HOU_2119 (coaA)
    VC40:
    SAVC_09525

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKVGIDAGGTLIKIVQEQDNQRTFKTELTKNIDQVVEWLNQQQIEKLCLTGGNAGVIAEN
    N315            MKVGIDAGGTLIKIVQEQDNQRTFKTELTKNIDQVVEWLNQQQIEKLCLTGGNAGVIAEN
    NCTC8325        MKVGIDAGGTLIKIVQEQDNQRTFKTELTKNIDQVVEWLNQQQIEKLCLTGGNAGVIAEN
    Newman          MKVGIDAGGTLIKIVQEQDNQRTFKTELTKNIDQVVEWLNQQQIEKLCLTGGNAGVIAEN
    USA300_FPR3757  MKVGIDAGGTLIKIVQEQDNQRTFKTELTKNIDQVVEWLNQQQIEKLCLTGGNAGVIAEN
                    ************************************************************

    COL             INIPAQIFVEFDAASQGLGILLKEQGHDLADYIFANVGTGTSLHYFDGQSQRRVGGIGTG
    N315            INIPAQIFVEFDAASQGLGILLKEQGHDLADYIFANVGTGTSLHYFDGQSQRRVGGIGTG
    NCTC8325        INIPAQIFVEFDAASQGLGILLKEQGHDLADYIFANVGTGTSLHYFDGQSQRRVGGIGTG
    Newman          INIPAQIFVEFDAASQGLGILLKEQGHDLADYIFANVGTGTSLHYFDGQSQRRVGGIGTG
    USA300_FPR3757  INIPAQIFVEFDAASQGLGILLKEQGHDLADYIFANVGTGTSLHYFDGQSQRRVGGIGTG
                    ************************************************************

    COL             GGMIQGLGYLLSQITDYKQLTDMAQHGDRNTIDLKVRHIYKDTEPPIPGDLTAANFGHVL
    N315            GGMIQGLGYLLSQITDYKQLTDMAQHGDRNTIDLKVRHIYKDTEPPIPGDLTAANFGHVL
    NCTC8325        GGMIQGLGYLLSQITDYKQLTDMAQHGDRNTIDLKVRHIYKDTEPPIPGDLTAANFGHVL
    Newman          GGMIQGLGYLLSQITDYKQLTDMAQHGDRNTIDLKVRHIYKDTEPPIPGDLTAANFGHVL
    USA300_FPR3757  GGMIQGLGYLLSQITDYKQLTDMAQHGDRNTIDLKVRHIYKDTEPPIPGDLTAANFGHVL
                    ************************************************************

    COL             HHLDADFTPSNKLAAVIGVVGEVVTTMAITVAREFKTENIVYIGSSFHNNALLRKVVEDY
    N315            HHLDADFTPSNKLAAVIGVVGEVVTTMAITVAREFKTENIVYIGSSFHNNALLRKVVEDY
    NCTC8325        HHLDADFTPSNKLAAVIGVVGEVVTTMAITVAREFKTENIVYIGSSFHNNALLRKVVEDY
    Newman          HHLDADFTPSNKLAAVIGVVGEVVTTMAITVAREFKTENIVYIGSSFHNNALLRKVVEDY
    USA300_FPR3757  HHLDADFTPSNKLAAVIGVVGEVVTTMAITVAREFKTENIVYIGSSFHNNALLRKVVEDY
                    ************************************************************

    COL             TVLRGCKPYYVENGAFSGAIGALYLEK
    N315            TVLRGCKPYYVENGAFSGAIGALYLGK
    NCTC8325        TVLRGCKPYYVENGAFSGAIGALYLEK
    Newman          TVLRGCKPYYVENGAFSGAIGALYLEK
    USA300_FPR3757  TVLRGCKPYYVENGAFSGAIGALYLEK
                    ************************* *