From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005507000
  • symbol?:
  • description?: membrane associated protein

      descriptions from strain specific annotations:

    • membrane associated protein
    • pseudogene
    • putative secreted protein YBBR
    • ybbR-like family protein
  • strand?: -
  • coordinates?: 5672159..5673092
  • synteny block?: BlockID0042890
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2101
    08BA02176:
    C248_2190
    11819-97:
    MS7_2177
    71193:
    ST398NM01_2217
    ECT-R 2:
    ECTR2_2015
    ED133:
    SAOV_2201c
    ED98:
    SAAV_2216
    HO 5096 0412:
    SAEMRSA15_20680
    JH1:
    SaurJH1_2232
    JH9:
    SaurJH9_2194
    JKD6008:
    SAA6008_02199
    JKD6159:
    SAA6159_02071
    LGA251:
    SARLGA251_19580
    M013:
    M013TW_2120
    MRSA252:
    SAR2253
    MSHR1132:
    SAMSHR1132_19940
    MSSA476:
    SAS2064
    Mu3:
    SAHV_2146
    Mu50:
    SAV2162
    MW2:
    MW2089
    RF122:
    SAB2042c
    ST398:
    SAPIG2217
    T0131:
    SAT0131_02327
    TCH60:
    HMPREF0772_11030
    TW20:
    SATW20_22970
    USA300_TCH1516:
    USA300HOU_2152
    VC40:
    SAVC_09675

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLESKWGLRFIAFLLALFFFLSVNNVFGNIFNTGNLGQKSSKTIQDVPVEILYNTKDLHL
    N315            MLESKWGLRFIAFLLALFFFLSVNNVFGNIFNTGNLGQKSSKTIQDVPVEILYNTKDLHL
    NCTC8325        MLESKWGLRFIAFLLALFFFLSVNNVFGNIFNTGNLGQKSSKTIQDVPVEILYNTKDLHL
    Newman          MLESKWGLRFIAFLLALFFFLSVNNVFGNIFNTGNLGQKSSKTIQDVPVEILYNTKDLHL
    USA300_FPR3757  MLESKWGLRFIAFLLALFFFLSVNNVFGNIFNTGNLGQKSSKTIQDVPVEILYNTKDLHL
                    ************************************************************

    COL             TKAPETVNVTISGPQSKIIKIENPEDLRVVIDLSNAKAGKYQEKYQVKGLADDIHYSVKP
    N315            TKAPETVNVTISGPQSKIIKIENPEDLRVVIDLSNAKAGKYQEKYQVKGLADDIHYSVKP
    NCTC8325        TKAPETVNVTISGPQSKIIKIENPEDLRVVIDLSNAKAGKYQEKYQVKGLADDIHYSVKP
    Newman          TKAPETVNVTISGPQSKIIKIENPEDLRVVIDLSNAKAGKYQEKYQVKGLADDIHYSVKP
    USA300_FPR3757  TKAPETVNVTISGPQSKIIKIENPEDLRVVIDLSNAKAGKYQEKYQVKGLADDIHYSVKP
                    ************************************************************

    COL             KLANITLENKVTKKMTVQPDVSQSDIDPLYKITKQEVSPQTVKVTGGEEQLNDIAYLKAT
    N315            KLANITLENKVTKKMTVQPDVSQSDIDPLYKITKQEVSPQTVKVTGGEEQLNDIAYLKAT
    NCTC8325        KLANITLENKVTKKMTVQPDVSQSDIDPLYKITKQEVSPQTVKVTGGEEQLNDIAYLKAT
    Newman          KLANITLENKVTKKMTVQPDVSQSDIDPLYKITKQEVSPQTVKVTGGEEQLNDIAYLKAT
    USA300_FPR3757  KLANITLENKVTKKMTVQPDVSQSDIDPLYKITKQEVSPQTVKVTGGEEQLNDIAYLKAT
                    ************************************************************

    COL             FKTNKKINGDTKDVAEVTAFDKKLNKLNVSIQPNEVNLQVKVEPFSKKVKVNVKQKGSLA
    N315            FKTNKKINGDTKDVAEVTAFDKKLNKLNVSIQPNEVNLQVKVEPFSKKVKVNVKQKGSLA
    NCTC8325        FKTNKKINGDTKDVAEVTAFDKKLNKLNVSIQPNEVNLQVKVEPFSKKVKVNVKQKGSLA
    Newman          FKTNKKINGDTKDVAEVTAFDKKLNKLNVSIQPNEVNLQVKVEPFSKKVKVNVKQKGSLA
    USA300_FPR3757  FKTNKKINGDTKDVAEVTAFDKKLNKLNVSIQPNEVNLQVKVEPFSKKVKVNVKQKGSLA
                    ************************************************************

    COL             DDKELSSIDLEDKEIEIFGSRDDLQNISEVDAEVDLDGISESTEKTVKINLPEHVTKAQP
    N315            DDKELSSIDLEDKEIEIFGSRDDLQNISEVDAEVDLDGISESTEKTVKINLPEHVTKAQP
    NCTC8325        DDKELSSIDLEDKEIEIFGSRDDLQNISEVDAEVDLDGISESTEKTVKINLPEHVTKAQP
    Newman          DDKELSSIDLEDKEIEIFGSRDDLQNISEVDAEVDLDGISESTEKTVKINLPEHVTKAQP
    USA300_FPR3757  DDKELSSIDLEDKEIEIFGSRDDLQNISEVDAEVDLDGISESTEKTVKINLPEHVTKAQP
                    ************************************************************

    COL             SETKAYINVK
    N315            SETKAYINVK
    NCTC8325        SETKAYINVK
    Newman          SETKAYINVK
    USA300_FPR3757  SETKAYINVK
                    **********