From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005553000
  • symbol?: salA
  • description?: chromosome partitioning protein ParA

      descriptions from strain specific annotations:

    • chromosome partitioning protein ParA
    • ATP-binding Mrp/Nbp35 family protein
    • ATP-binding protein, Mrp/Nbp35 family
    • ATP-binding protein Mrp-like protein
    • chromosome partitioning ATPase
    • cobQ/CobB/MinD/ParA nucleotide binding domain protein
    • Iron-sulfur cluster assembly/repair protein ApbC
    • mrp/Nbp35 family ATP-binding protein
    • multidrug resistance protein
    • Scaffold protein for cluster assemblyApbC, MRP-like protein
  • strand?: -
  • coordinates?: 5695810..5696738
  • synteny block?: BlockID0043140
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2104 (apbC)
    08BA02176:
    C248_2202
    11819-97:
    MS7_2189
    71193:
    ST398NM01_2226
    ECT-R 2:
    ECTR2_2027
    ED133:
    SAOV_2213c
    ED98:
    SAAV_2227
    HO 5096 0412:
    SAEMRSA15_20710
    JH1:
    SaurJH1_2235
    JH9:
    SaurJH9_2197
    JKD6008:
    SAA6008_02204
    JKD6159:
    SAA6159_02077
    LGA251:
    SARLGA251_19610
    M013:
    M013TW_2132
    MRSA252:
    SAR2256
    MSHR1132:
    SAMSHR1132_19980
    MSSA476:
    SAS2067
    Mu3:
    SAHV_2149
    Mu50:
    SAV2165
    MW2:
    MW2092
    RF122:
    SAB2047c
    ST398:
    SAPIG2226
    T0131:
    SAT0131_02334
    TCH60:
    HMPREF0772_11026
    TW20:
    SATW20_23010
    USA300_TCH1516:
    USA300HOU_2157
    VC40:
    SAVC_09700

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLTVDQVKELVGEIKDPIIDVPLKETEGIVEVSIKEEKEHVSVKLAMAQLGGAPQLDLQM
    N315            MLTVDQVKELVGEIKDPIIDVPLKETEGIVEVSIKEEKEHVSVKLAMAQLGGAPQLDLQM
    NCTC8325        MLTVDQVKELVGEIKDPIIDVPLKETEGIVEVSIKEEKEHVSVKLAMAQLGGAPQLDLQM
    Newman          MLTVDQVKELVGEIKDPIIDVPLKETEGIVEVSIKEEKEHVSVKLAMAQLGGAPQLDLQM
    USA300_FPR3757  --------------------MPLKETEGIVEVSIKEEKEHVSVKLAMAQLGGAPQLDLQM
                                        :***************************************

    COL             AVVNALKENGAKTVGIRFETLPEEKVNQFKPKEENKPKTIEGLLSQNNPVEFIAIASGKG
    N315            AVVNALKENGAKTVGIRFETLPEEKVNQFKPKEENKPKTIEGLLSQNNPVEFIAIASGKG
    NCTC8325        AVVNALKENGAKTVGIRFETLPEEKVNQFKPKEENKPKTIEGLLSQNNPVEFIAIASGKG
    Newman          AVVNALKENGAKTVGIRFETLPEEKVNQFKPKEENKPKTIEGLLSQNNPVEFIAIASGKG
    USA300_FPR3757  AVVNALKENGAKTVGIRFETLPEEKVNQFKPKEENKPKTIEGLLSQNNPVEFIAIASGKG
                    ************************************************************

    COL             GVGKSTVAVNLAVALAREGKKVGLVDADIYGFSVPDMMGIDEKPGIKGKEVIPVERHGVK
    N315            GVGKSTVAVNLAVALAREGKKVGLVDADIYGFSVPDMMGIDEKPGIKGKEVIPVERHGVK
    NCTC8325        GVGKSTVAVNLAVALAREGKKVGLVDADIYGFSVPDMMGIDEKPGIKGKEVIPVERHGVK
    Newman          GVGKSTVAVNLAVALAREGKKVGLVDADIYGFSVPDMMGIDEKPGIKGKEVIPVERHGVK
    USA300_FPR3757  GVGKSTVAVNLAVALAREGKKVGLVDADIYGFSVPDMMGIDEKPGIKGKEVIPVERHGVK
                    ************************************************************

    COL             VISMAFFVEENAPVIWRGPMLGKMLTNFFTEVKWGDIEYLILDLPPGTGDVALDVHTMLP
    N315            VISMAFFVEENAPVIWRGPMLGKMLTNFFTEVKWGDIEYLILDLPPGTGDVALDVHTMLP
    NCTC8325        VISMAFFVEENAPVIWRGPMLGKMLTNFFTEVKWGDIEYLILDLPPGTGDVALDVHTMLP
    Newman          VISMAFFVEENAPVIWRGPMLGKMLTNFFTEVKWGDIEYLILDLPPGTGDVALDVHTMLP
    USA300_FPR3757  VISMAFFVEENAPVIWRGPMLGKMLTNFFTEVKWGDIEYLILDLPPGTGDVALDVHTMLP
                    ************************************************************

    COL             SSKEIIVTTPHPTAAFVAARAGAMAKHTDHSILGVIENMSYFESKETGNKEYVFGKGGGT
    N315            SSKEIIVTTPHPTAAFVAARAGAMAKHTDHSILGVIENMSYFESKETGNKEYVFGKGGGT
    NCTC8325        SSKEIIVTTPHPTAAFVAARAGAMAKHTDHSILGVIENMSYFESKETGNKEYVFGKGGGT
    Newman          SSKEIIVTTPHPTAAFVAARAGAMAKHTDHSILGVIENMSYFESKETGNKEYVFGKGGGT
    USA300_FPR3757  SSKEIIVTTPHPTAAFVAARAGAMAKHTDHSILGVIENMSYFESKETGNKEYVFGKGGGT
                    ************************************************************

    COL             KLADELNTQLLGELPLEQPSWNPKDFAPSIYQSDDRLGKIYSSIAQKVIAATNK
    N315            KLADELNTQLLGELPLEQPSWNPKDFAPSIYQSDDRLGKIYSSIAQKVIAATNK
    NCTC8325        KLADELNTQLLGELPLEQPSWNPKDFAPSIYQSDDRLGKIYSSIAQKVIAATNK
    Newman          KLADELNTQLLGELPLEQPSWNPKDFAPSIYQSDDRLGKIYSSIAQKVIAATNK
    USA300_FPR3757  KLADELNTQLLGELPLEQPSWNPKDFAPSIYQSDDRLGKIYSSIAQKVIAATNK
                    ******************************************************