From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005560000
  • symbol?:
  • description?: uridylyltransferase

      descriptions from strain specific annotations:

    • uridylyltransferase
    • UTP-glucose-1-phosphate uridylyltransferase
    • UDP-N-acetylglucosamine pyrophosphorylase
    • UTP-glucose-1-phosphate uridylyltransferase family protein
    • N-acetylglucosamine-1-phosphate uridyltransferase eukaryotic
    • putative UTP--glucose-1-phosphateuridylyltransferase
    • probable uridylyltransferase
    • putative uridylyltransferase
  • strand?: -
  • coordinates?: 5702299..5703486
  • synteny block?: BlockID0043200
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2109
    08BA02176:
    C248_2207
    11819-97:
    MS7_2194
    71193:
    ST398NM01_2231
    ECT-R 2:
    ECTR2_2032
    ED133:
    SAOV_2218c
    ED98:
    SAAV_2232
    HO 5096 0412:
    SAEMRSA15_20760
    JH1:
    SaurJH1_2240
    JH9:
    SaurJH9_2202
    JKD6008:
    SAA6008_02209
    JKD6159:
    SAA6159_02082
    LGA251:
    SARLGA251_19660
    M013:
    M013TW_2137
    MRSA252:
    SAR2262
    MSHR1132:
    SAMSHR1132_20030
    MSSA476:
    SAS2072
    Mu3:
    SAHV_2155
    Mu50:
    SAV2171
    MW2:
    MW2097
    RF122:
    SAB2052c
    ST398:
    SAPIG2231
    T0131:
    SAT0131_02340
    TCH60:
    HMPREF0772_11021
    TW20:
    SATW20_23060
    USA300_TCH1516:
    USA300HOU_2162
    VC40:
    SAVC_09725

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLDKNQLAKYKQDHLCEYEKIMSNNEKEALEEKVASLDLDFIAKLYNDLYINKKTIDDVS
    N315            MLDKNQLAKYKQDHLCEYEKIMSNNEKEALEEKVASLDLDFIAKLYNDLYINKKTIDDVS
    NCTC8325        MLDKNQLAKYKQDHLCEYEKIMSNNEKEALEEKVASLDLDFIAKLYNDLYINKKTIDDVS
    Newman          MLDKNQLAKYKQDHLCEYEKIMSNNEKEALEEKVASLDLDFIAKLYNDLYINKKTIDDVS
    USA300_FPR3757  MLDKNQLAKYKQDHLCEYEKIMSNNEKEALEEKVASLDLDFIAKLYNDLYINKKTIDDVS
                    ************************************************************

    COL             AVSEVKYDIKSQMSDDEIKRLEEQGLQAIKEGQFAVLLMAGGQGTRLGYKGPKGSFEIEG
    N315            AVSEVKYDIKSQMSDDEIKRLEEQGLQAIKEGQFAVLLMAGGQGTRLGYKGPKGSFEIEG
    NCTC8325        AVSEVKYDIKSQMSDDEIKRLEEQGLQAIKEGQFAVLLMAGGQGTRLGYKGPKGSFEIEG
    Newman          AVSEVKYDIKSQMSDDEIKRLEEQGLQAIKEGQFAVLLMAGGQGTRLGYKGPKGSFEIEG
    USA300_FPR3757  AVSEVKYDIKSQMSDDEIKRLEEQGLQAIKEGQFAVLLMAGGQGTRLGYKGPKGSFEIEG
                    ************************************************************

    COL             VSLFELQANQLKTLNHQSGHTIQWYIMTSDINHEETLAYFEAHSYFGYDQEAIHFFKQDN
    N315            VSLFELQANQLKTLNHQSGHTIQWYIMTSDINHEETLAYFEAHSYFGYDQEAIHFFKQDN
    NCTC8325        VSLFELQANQLKTLNHQSGHTIQWYIMTSDINHEETLAYFEAHSYFGYDQEAIHFFKQDN
    Newman          VSLFELQANQLKTLNHQSGHTIQWYIMTSDINHEETLAYFEAHSYFGYDQEAIHFFKQDN
    USA300_FPR3757  VSLFELQANQLKTLNHQSGHTIQWYIMTSDINHEETLAYFEAHSYFGYDQEAIHFFKQDN
                    ************************************************************

    COL             IVALSEEGKLILNQQGRIMETPNGNGGVFKSLDKAGYLEEMSNNGVKYIFLNNIDNVLVR
    N315            IVALSEEGKLILNQQGRIMETPNGNGGVFKSLDKAGYLEEMSNNGVKYIFLNNIDNVLVK
    NCTC8325        IVALSEEGKLILNQQGRIMETPNGNGGVFKSLDKAGYLEEMSNNGVKYIFLNNIDNVLVR
    Newman          IVALSEEGKLILNQQGRIMETPNGNGGVFKSLDKAGYLEEMSNNGVKYIFLNNIDNVLVR
    USA300_FPR3757  IVALSEEGKLILNQQGRIMETPNGNGGVFKSLDKAGYLEEMSNNGVKYIFLNNIDNVLVR
                    ***********************************************************:

    COL             VLDPLFAGFTVEHDYDITSKTIQPKPGESVGRLVNVDCKDTVLEYSELDPEVANQFNNAN
    N315            VLDPLFAGFTVEHDYDITSKTIQPKPGESVGRLVNVDCKDTVLEYSELDPEVANQFNNAN
    NCTC8325        VLDPLFAGFTVEHDYDITSKTIQPKPGESVGRLVNVDCKDTVLEYSELDPEVANQFNNAN
    Newman          VLDPLFAGFTVEHDYDITSKTIQPKPGESVGRLVNVDCKDTVLEYSELDPEVANQFNNAN
    USA300_FPR3757  VLDPLFAGFTVEHDYDITSKTIQPKPGESVGRLVNVDCKDTVLEYSELDPEVANQFNNAN
                    ************************************************************

    COL             IGIHAFKLGFILNAVNRELPYHLAIKNLKQLDENFGVIEQPTLKFELFYFDIFTYGTSFV
    N315            IGIHAFKLGFILNAVNRELPYHLAIKNLKQLDENFGVIEQPTLKFELFYFDIFTYGTSFV
    NCTC8325        IGIHAFKLGFILNAVNRELPYHLAIKNLKQLDENFGVIEQPTLKFELFYFDIFTYGTSFV
    Newman          IGIHAFKLGFILNAVNRELPYHLAIKNLKQLDENFGVIEQPTLKFELFYFDIFTYGTSFV
    USA300_FPR3757  IGIHAFKLGFILNAVNRELPYHLAIKNLKQLDENFGVIEQPTLKFELFYFDIFTYGTSFV
                    ************************************************************

    COL             TLQVPREEEFSPLKNKEGKDSVATATEDLRRMGLI
    N315            TLQVPREEEFSPLKNKEGKDSVATATEDLRRMGLI
    NCTC8325        TLQVPREEEFSPLKNKEGKDSVATATEDLRRMGLI
    Newman          TLQVPREEEFSPLKNKEGKDSVATATEDLRRMGLI
    USA300_FPR3757  TLQVPREEEFSPLKNKEGKDSVATATEDLRRMGLI
                    ***********************************