From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005581000
  • symbol?: opuD2
  • description?: choline/carnitine/betaine transporter

      descriptions from strain specific annotations:

    • choline/carnitine/betaine transporter
    • BCCT family osmoprotectant transporter
    • Glycine betaine transporter OpuD
    • glycine betaine transporter opuD-like protein
    • glycine betaine transporter 2
    • transporter, betaine/carnitine/choline transporter family protein
    • BCCT family betaine/carnitine/choline transporter
    • choline transport protein BetT
    • Osmoprotectant transporter
  • strand?: -
  • coordinates?: 5719794..5721356
  • synteny block?: BlockID0043410
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2176 (opuD2)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2123 (opuD)
    08BA02176:
    C248_2223 (opuD2)
    11819-97:
    MS7_2208
    71193:
    ST398NM01_2245
    ECT-R 2:
    ECTR2_2046
    ED133:
    SAOV_2232c
    ED98:
    SAAV_2246 (opuD2)
    HO 5096 0412:
    SAEMRSA15_20900 (opuD2)
    JH1:
    SaurJH1_2255
    JH9:
    SaurJH9_2216
    JKD6008:
    SAA6008_02226 (betT)
    JKD6159:
    SAA6159_02096 (betT)
    LGA251:
    SARLGA251_19800 (opuD2)
    M013:
    M013TW_2151
    MRSA252:
    SAR2276 (opuD2)
    MSHR1132:
    SAMSHR1132_20170
    MSSA476:
    SAS2086
    Mu3:
    SAHV_2169
    Mu50:
    SAV2185
    MW2:
    MW2111
    RF122:
    SAB2066c (opuD)
    ST398:
    SAPIG2245
    T0131:
    SAT0131_02358 (sspA)
    TCH60:
    HMPREF0772_11006 (opuD)
    TW20:
    SATW20_23230 (opuD2)
    USA300_TCH1516:
    USA300HOU_2178
    VC40:
    SAVC_09815

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKNKSVSLVFWVSLVICTIFVAFGAIFPKQLEKLTQNITTFIALHFSWYYLLLVLVILFV
    N315            MKNKSVSLVFWVSLVICTIFVAFGAIFPKQLEKLTQNITTFIALHFSWYYLLLVLVILFV
    NCTC8325        MKNKSVSLVFWVSLVICTIFVAFGAIFPKQLEKLTQNITTFIALHFSWYYLLLVLVILFV
    Newman          MKNKSVSLVFWVSLVICTIFVAFGAIFPKQLEKLTQNITTFIALHFSWYYLLLVLVILFV
    USA300_FPR3757  MKNKSVSLVFWVSLVICTIFVAFGAIFPKQLEKLTQNITTFIALHFSWYYLLLVLVILFV
                    ************************************************************

    COL             CVYILFSRYANITLGEEGEDPEFSLPSWFAMLFSAGMGIGLVFWTTAEPISHAFKLTPIH
    N315            CVYILFSRYANITLGEEGEDPEFSLPSWFAMLFSAGMGIGLVFWTTAEPISHAFKLTPIH
    NCTC8325        CVYILFSRYANITLGEEGEDPEFSLPSWFAMLFSAGMGIGLVFWTTAEPISHAFKLTPIH
    Newman          CVYILFSRYANITLGEEGEDPEFSLPSWFAMLFSAGMGIGLVFWTTAEPISHAFKLTPIH
    USA300_FPR3757  CVYILFSRYANITLGEEGEDPEFSLPSWFAMLFSAGMGIGLVFWTTAEPISHAFKLTPIH
                    ************************************************************

    COL             KAGTQSAINDAMQFSFFHWGIHAWAVYGIVALVFAYFSFHKGYPGLVSATLTPLLGEKAM
    N315            KAGTQSAINDAMQFSFFHWGIHAWAVYGIVALVFAYFSFHKGYPGLVSATLTPLLGEKAM
    NCTC8325        KAGTQSAINDAMQFSFFHWGIHAWAVYGIVALVFAYFSFHKGYPGLVSATLTPLLGEKAM
    Newman          KAGTQSAINDAMQFSFFHWGIHAWAVYGIVALVFAYFSFHKGYPGLVSATLTPLLGEKAM
    USA300_FPR3757  KAGTQSAINDAMQFSFFHWGIHAWAVYGIVALVFAYFSFHKGYPGLVSATLTPLLGEKAM
                    ************************************************************

    COL             RGPLGGAIDVLAVIATVTGVAATLGFGALQINEGLHFLFNVPSNFTMQVILIVIATILFT
    N315            RGPLGGAIDVLAVIATVTGVAATLGFGALQINEGLHFLFNVPSNFTMQVILIVIATILFT
    NCTC8325        RGPLGGAIDVLAVIATVTGVAATLGFGALQINEGLHFLFNVPSNFTMQVILIVIATILFT
    Newman          RGPLGGAIDVLAVIATVTGVAATLGFGALQINEGLHFLFNVPSNFTMQVILIVIATILFT
    USA300_FPR3757  RGPLGGAIDVLAVIATVTGVAATLGFGALQINEGLHFLFNVPSNFTMQVILIVIATILFT
                    ************************************************************

    COL             WSAWSGIDKGIKTLSNINMLLAFVVLIGLFIVGPTLYILNTFTNGLGNYIANFFSMSLRI
    N315            WSAWSGIDKGIKTLSNINMLLAFVVLIGLFIVGPTLYILNTFTNGLGNYIANFFSMSLRI
    NCTC8325        WSAWSGIDKGIKTLSNINMLLAFVVLIGLFIVGPTLYILNTFTNGLGNYIANFFSMSLRI
    Newman          WSAWSGIDKGIKTLSNINMLLAFVVLIGLFIVGPTLYILNTFTNGLGNYIANFFSMSLRI
    USA300_FPR3757  WSAWSGIDKGIKTLSNINMLLAFVVLIGLFIVGPTLYILNTFTNGLGNYIANFFSMSLRI
                    ************************************************************

    COL             PTGGQKFQWLQNWTIFYWAWWISWAPFVGIFIARVSKGRTIKEFILGVLFVPALVCFIFF
    N315            PSGGQKFQWLQNWTIFYWAWWISWAPFVGIFIARVSKGRTIKEFILGVLFVPALVCFIFF
    NCTC8325        PTGGQKFQWLQNWTIFYWAWWISWAPFVGIFIARVSKGRTIKEFILGVLFVPALVCFIFF
    Newman          PTGGQKFQWLQNWTIFYWAWWISWAPFVGIFIARVSKGRTIKEFILGVLFVPALVCFIFF
    USA300_FPR3757  PTGGQKFQWLQNWTIFYWAWWISWAPFVGIFIARVSKGRTIKEFILGVLFVPALVCFIFF
                    *:**********************************************************

    COL             AVFGASAIYLQDNHIADIAKAATETATFATLQHYPLGFVLSLITLLVIMIFFVTSADSAT
    N315            AVFGASAIYLQDNHIADIAKAATETATFATLQHYPLGFVLSLITLLVIMIFFVTSADSAT
    NCTC8325        AVFGASAIYLQDNHIADIAKAATETATFATLQHYPLGFVLSLITLLVIMIFFVTSADSAT
    Newman          AVFGASAIYLQDNHIADIAKAATETATFATLQHYPLGFVLSLITLLVIMIFFVTSADSAT
    USA300_FPR3757  AVFGASAIYLQDNHIADIAKAATETATFATLQHYPLGFVLSLITLLVIMIFFVTSADSAT
                    ************************************************************

    COL             YVLGMLSSSGDINPKSFVKVSWGIIMALFAIIMIYTGGTQAIQNLLIIAALPFSVVIIAM
    N315            YVLGMLSSRGDINPKSFVKVSWGIIMALFAIIMIYTGGTQAIQNLLIIAALPFSVVIIAM
    NCTC8325        YVLGMLSSSGDINPKSFVKVSWGIIMALFAIIMIYTGGTQAIQNLLIIAALPFSVVIIAM
    Newman          YVLGMLSSSGDINPKSFVKVSWGIIMALFAIIMIYTGGTQAIQNLLIIAALPFSVVIIAM
    USA300_FPR3757  YVLGMLSSSGDINPKSFVKVSWGIIMALFAIIMIYTGGTQAIQNLLIIAALPFSVVIIAM
                    ******** ***************************************************

    COL             IWSLIKSLSEEKPRNSNKVLIKHRDPDILEYRSSKHIDEN
    N315            IWSLLKSLSEEKPRNSNKVLIKHRDPDILEYRSSKHIDEN
    NCTC8325        IWSLIKSLSEEKPRNSNKVLIKHRDPDILEYRSSKHIDEN
    Newman          IWSLIKSLSEEKPRNSNKVLIKHRDPDILEYRSSKHIDEN
    USA300_FPR3757  IWSLIKSLSEEKPRNSNKVLIKHRDPDILEYRSSKHIDEN
                    ****:***********************************